Search by BoMiProt ID - Bomi5816


Primary Information

BoMiProt ID Bomi5816
Protein Name Follistatin/Activin-binding protein
Organism Bos taurus
Uniprot IdP50291
Milk FractionWhey
Ref Sequence Id NP_786995.2
Aminoacid Length 344
Molecular Weight 37958
Fasta Sequence https://www.uniprot.org/uniprot/P50291.fasta
Gene Name FST
Gene Id 327681
Protein Existence Status reviewed

Secondary Information

Protein Function Binds directly to activin and functions as an activin antagonist. Specific inhibitor of the biosynthesis and secretion of pituitary follicle stimulating hormone (FSH).Cellular Proliferation and cellular differentiation
Biochemical Properties three reported isoforms, FS-288, FS-300, and FS-315
Significance in milk bovine early embryonic development
PTMs Disulfide bond, Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P50291|FST_BOVIN Follistatin OS=Bos taurus OX=9913 GN=FST PE=2 SV=2 MARPRHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGR LSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAP DCSN*124ITWKGPVCGLDGKTYRNECALLKARCKEQPELQVQYQGKCKKTCRDVFCPGSSTCV VDQTNNAYCVTCNRICPEPTSSEQYLCGNDGVTYPSACHLRKATCLLGRSIGLAYEGKCI KAKSCDDIQCTGGKKCLWDFKVGRGRCSLCGELCPESKSEEPVCASDN*288ATYASECAMKEA ACSSGVLLEVKHSGSCNSISEDTEDEEEDEDQDYSFPISSILEW
Predicted Disorder Regions 3 predicted disordered segments;(106-108), (247-249), (317-344)
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Follistatin is critical for mouse uterine receptivity and decidualization.In the absence of uterine FST, activin B expression and signaling are up-regulated, and bone morphogenetic protein (BMP) signals are impaired.Circulating follistatin is increased in conditions associated with insulin resistance.The glucagon-to-insulin ratio has been identified to regulate circulating follistatin.
Bibliography 1.Kyung-Bon Lee, Anilkumar Bettegowda, Gabbine Wee, James J. Ireland, George W. Smith, Molecular Determinants of Oocyte Competence: Potential Functional Role for Maternal (Oocyte-Derived) Follistatin in Promoting Bovine Early Embryogenesis, Endocrinology, Volume 150, Issue 5, 1 May 2009, Pages 2463–2471, https://doi.org/10.1210/en.2008-1574 2.Fullerton PT Jr, Monsivais D, Kommagani R, Matzuk MM. Follistatin is critical for mouse uterine receptivity and decidualization. Proc Natl Acad Sci U S A. 2017 Jun 13;114(24):E4772-E4781. doi: 10.1073/pnas.1620903114. Epub 2017 May 30. PMID: 28559342; PMCID: PMC5474784.