Primary Information |
---|
BoMiProt ID | Bomi5816 |
---|
Protein Name | Follistatin/Activin-binding protein |
---|
Organism | Bos taurus |
---|
Uniprot Id | P50291 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_786995.2 |
---|
Aminoacid Length | 344 |
---|
Molecular Weight | 37958 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/P50291.fasta |
---|
Gene Name | FST |
---|
Gene Id | 327681 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Binds directly to activin and functions as an activin antagonist. Specific inhibitor of the biosynthesis and secretion of pituitary follicle stimulating hormone (FSH).Cellular Proliferation and cellular differentiation |
---|
Biochemical Properties | three reported isoforms, FS-288, FS-300, and FS-315 |
---|
Significance in milk | bovine early embryonic development |
---|
PTMs | Disulfide bond, Glycosylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P50291|FST_BOVIN Follistatin OS=Bos taurus OX=9913 GN=FST PE=2 SV=2
MARPRHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGR
LSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAP
DCSN*124ITWKGPVCGLDGKTYRNECALLKARCKEQPELQVQYQGKCKKTCRDVFCPGSSTCV
VDQTNNAYCVTCNRICPEPTSSEQYLCGNDGVTYPSACHLRKATCLLGRSIGLAYEGKCI
KAKSCDDIQCTGGKKCLWDFKVGRGRCSLCGELCPESKSEEPVCASDN*288ATYASECAMKEA
ACSSGVLLEVKHSGSCNSISEDTEDEEEDEDQDYSFPISSILEW |
---|
Predicted Disorder Regions | 3 predicted disordered segments;(106-108), (247-249), (317-344) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | Follistatin is critical for mouse uterine receptivity and decidualization.In the absence of uterine FST, activin B expression and signaling are up-regulated, and bone morphogenetic protein (BMP) signals are impaired.Circulating follistatin is increased in conditions associated with insulin resistance.The glucagon-to-insulin ratio has been identified to regulate circulating follistatin. |
---|
Bibliography | 1.Kyung-Bon Lee, Anilkumar Bettegowda, Gabbine Wee, James J. Ireland, George W. Smith, Molecular Determinants of Oocyte Competence: Potential Functional Role for Maternal (Oocyte-Derived) Follistatin in Promoting Bovine Early Embryogenesis, Endocrinology, Volume 150, Issue 5, 1 May 2009, Pages 2463–2471, https://doi.org/10.1210/en.2008-1574 2.Fullerton PT Jr, Monsivais D, Kommagani R, Matzuk MM. Follistatin is critical for mouse uterine receptivity and decidualization. Proc Natl Acad Sci U S A. 2017 Jun 13;114(24):E4772-E4781. doi: 10.1073/pnas.1620903114. Epub 2017 May 30. PMID: 28559342; PMCID: PMC5474784. |