Search by BoMiProt ID - Bomi5807


Primary Information

BoMiProt ID Bomi5807
Protein Name Fin bud initiation factor homolog
Organism Bos taurus
Uniprot IdQ5E9H1
Milk FractionWhey
Ref Sequence Id NP_001015541.1
Aminoacid Length 211
Molecular Weight 24233
Fasta Sequence https://www.uniprot.org/uniprot/Q5E9H1.fasta
Gene Name FIBIN
Gene Id 507975
Protein Existence Status Reviewed

Secondary Information

Protein Function Fin bud initiation factor homolog possesses the protein homodimerization activity
PTMs Glycosylation and Disulphide bond
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5E9H1|FIBIN_BOVIN Fin bud initiation factor homolog OS=Bos taurus OX=9913 GN=FIBIN PE=2 SV=1 MVFLKFLWMGFLCHLCQGYFDGPLYPEMSN*30GTLHHYFVPDGDYEENDDPEKCQLLFRVSD HRRCSQGEGSSASTLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLR RESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDIS VGLRDKYELLALTIRSHGTRLGRLKNDYLKV
Predicted Disorder Regions 39-47, 66-73, 125-157
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Harhay, G. P., Sonstegard, T. S., Keele, J. W., Heaton, M. P., Clawson, M. L., Snelling, W. M., Wiedmann, R. T., Van Tassell, C. P., & Smith, T. P. (2005). Characterization of 954 bovine full-CDS cDNA sequences. BMC genomics, 6, 166. https://doi.org/10.1186/1471-2164-6-166