Search by BoMiProt ID - Bomi5800


Primary Information

BoMiProt ID Bomi5800
Protein Name Ficolin-2/Collagen/fibrinogen domain-containing protein 2/Ficolin-B/Ficolin-beta/L-ficolin
Organism Bos taurus
Uniprot IdQ5I2E5
Milk FractionWhey
Ref Sequence Id NP_001010996.1
Aminoacid Length 329
Molecular Weight 35339
Fasta Sequence https://www.uniprot.org/uniprot/Q5I2E5.fasta
Gene Name FCN2
Gene Id 497016
Protein Existence Status reviewed

Secondary Information

Protein Function soluble pattern recognition molecules that contribute to complement activation via the lectin pathway.ficolin-2 can bind to glycoproteins of pathogens including viral (Hepatitis C Virus, Influenza A virus and Human Immunodeficiency Virus) and virulent Mycobacterium tuberculosis and inhibit viral and bacterial infections.Ficolin-2 could bind to mannose-capped lipoarabinomannan .
Significance in milk Pathogen recognition molecules
PTMs Glycosylation,Disulfide bond formation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5I2E5|FCN2_BOVIN Ficolin-2 OS=Bos taurus OX=9913 GN=FCN2 PE=2 SV=1 MELGGAAGALGPSGPLLVCLCFGTLAAQAADTCPEVKLVGLEGSDKLSILRGCPGLPGAP GLKGETGAAGLKGERGLPGVPGKAGPAGPKGSTGAQGEKGARGEKGESGQLHSCATGPRT CTELLTRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRKDGSVDFFRTWTAYKQ GFGSQLGEFWLGNDNIHALTAQGTSELRVDLMDFEGNHRFAKYQSFRMADEAEKYKLVLG AFVEGNAGDSLTDHGNHFFSTKDRDNDESPSNCAAQFQGAWWYHSCHSSNLNGRYLRGPH TSYANGINWKSWGRYN*316YSYKVSEMKLRLT
Predicted Disorder Regions (66-98)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Ding Q, Shen Y, Li D, et al. Ficolin-2 triggers antitumor effect by activating macrophages and CD8+ T cells. Clinical Immunology (Orlando, Fla.). 2017 Oct;183:145-157. DOI: 10.1016/j.clim.2017.08.012. PMID: 28844702.