Search by BoMiProt ID - Bomi5782


Primary Information

BoMiProt ID Bomi5782
Protein Name Fibroblast growth factor 5
Organism Bos taurus
Uniprot IdA0MTF4
Milk FractionWhey
Ref Sequence Id NP_001071479.2
Aminoacid Length 270
Molecular Weight 29641
Fasta Sequence https://www.uniprot.org/uniprot/A0MTF4.fasta
Gene Name FGF5
Gene Id 536771
Protein Existence Status reviewed

Secondary Information

Protein Function  regulation of cell proliferation and cell differentiation via ERK and AKT activation.an inhibitor of hair elongation
Significance in milk Milk derived growth factors are important for treatment of gastrointestinal disorders and skin diseases, wound healing, and induction of oral tolerance.Stimulates the proliferation of epidermal, epithelial and embryonic cells.Inhibits the secretion of gastric acid.Promotes wound healing and bone resorption
PTMs N linked glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A0MTF4|FGF5_BOVIN Fibroblast growth factor 5 OS=Bos taurus OX=9913 GN=FGF5 PE=2 SV=1 MSLSFLLLLFLSHLILSAWAQGEKRLAPKGQPGPAATERNPGGASSRRSSSSTATSSSSP ASSSSAASRGGPGSSLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVN*112GSHEANML SILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAI HRTEKTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQLEQPELSFTVTVPEKKK PPNPVKPKVPLSAPRRSPNTVKYRLKFRFG
Predicted Disorder Regions 20-84, 200-213, 239-260
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs N terminal glycosylated sequence is important for it's secretion and its full activation.
Bibliography 1.Bates B, Hardin J, Zhan X, Drickamer K, Goldfarb M. Biosynthesis of human fibroblast growth factor-5. Mol Cell Biol. 1991 Apr;11(4):1840-5. doi: 10.1128/mcb.11.4.1840-1845.1991. PMID: 2005884; PMCID: PMC359856. 2.Hébert JM, Rosenquist T, Götz J, Martin GR. FGF5 as a regulator of the hair growth cycle: evidence from targeted and spontaneous mutations. Cell. 1994 Sep 23;78(6):1017-25. doi: 10.1016/0092-8674(94)90276-3. PMID: 7923352.