Search by BoMiProt ID - Bomi5726


Primary Information

BoMiProt ID Bomi5726
Protein Name F-box only protein 6/F-box protein that recognizes sugar chains 2
Organism Bos taurus
Uniprot IdQ3SX24
Milk FractionWhey
Ref Sequence Id NP_001029605.1
Aminoacid Length 265
Molecular Weight 30767
Fasta Sequence https://www.uniprot.org/uniprot/Q3SX24.fasta
Gene Name FBXO6/FBS2/FBX6
Gene Id 513023
Protein Existence Status reviewed

Secondary Information

Protein Function Responsible for regulated spindle checkpoint and chromosome segregation.Fbxo6-dependent Chk1 degradation contributes to S phase checkpoint termination.Also, induce premature sister-chromatid separation and accelerate the exit from mitosis. FBXO6 inhibits ER stress-induced apoptosis by modulating the protein level of Ero1L.Fbxo6 interacted with both Mad2 and BubR1 but not with Bub3, suggesting a direct role of Fbxo6 in regulating spindle checkpoint.
Biochemical Properties Contains F box associated (FBA) domain for interaction with multiple glycosylated proteins.It is a substrate recognition component of a Skp1-Cullin1-F-box protein (SCF) ubiquitin E3 ligase complex, recognizing the chitobiose in unfolded N-glycoprotein to target glycoproteins for polyubiquitination and degradation.
PTMs phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SX24|FBX6_BOVIN F-box only protein 6 OS=Bos taurus OX=9913 GN=FBXO6 PE=2 SV=1 MALVSINQLPENILLEVFMHVPARQLLRNCRPVCCLWRDLIDLVSLWKRKCLREGYVTED WDQPVSDWKVFYFLCSLRRNLLRNPCAEEDMKSWKIDSNGGDQWKVESLPGAHGTGFPDS KVKKYFVTSYDMCLKSQIIDLKAEGYWEELLDKFRPDIVVKDWFAPRADCGCTYQIRVQL ASADYLVLASFEPPPVTIHQWNDAKWTEVSHTFSDYPPGVRHIFFQHGGKDTQFWAGWYG PRVTNSSVVIS*251HRVTRNPPHAMAQP
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs phosphorylated by CDK1 during mitosis.
Bibliography 1.Xu HZ, Wang ZQ, Shan HZ, Zhou L, Yang L, Lei H, Liu B, Wu YL. Overexpression of Fbxo6 inactivates spindle checkpoint by interacting with Mad2 and BubR1. Cell Cycle. 2018;17(24):2779-2789. doi: 10.1080/15384101.2018.1557488. Epub 2018 Dec 18. PMID: 30526252; PMCID: PMC6343701. 2.Chen X, Duan LH, Luo PC, Hu G, Yu X, Liu J, Lu H, Liu B. FBXO6-Mediated Ubiquitination and Degradation of Ero1L Inhibits Endoplasmic Reticulum Stress-Induced Apoptosis. Cell Physiol Biochem. 2016;39(6):2501-2508. doi: 10.1159/000452517. Epub 2016 Nov 14. PMID: 27855403.