Primary Information |
---|
BoMiProt ID | Bomi5726 |
---|
Protein Name | F-box only protein 6/F-box protein that recognizes sugar chains 2 |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q3SX24 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001029605.1 |
---|
Aminoacid Length | 265 |
---|
Molecular Weight | 30767 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q3SX24.fasta |
---|
Gene Name | FBXO6/FBS2/FBX6 |
---|
Gene Id | 513023 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Responsible for regulated spindle checkpoint and chromosome segregation.Fbxo6-dependent Chk1 degradation contributes to S phase checkpoint termination.Also, induce premature sister-chromatid separation and accelerate the exit from mitosis. FBXO6 inhibits ER stress-induced apoptosis by modulating the protein level of Ero1L.Fbxo6 interacted with both Mad2 and BubR1 but not with Bub3, suggesting a direct role of Fbxo6 in regulating spindle checkpoint. |
---|
Biochemical Properties | Contains F box associated (FBA) domain for interaction with multiple glycosylated proteins.It is a substrate recognition component of a Skp1-Cullin1-F-box protein (SCF) ubiquitin E3 ligase complex, recognizing the chitobiose in unfolded N-glycoprotein to target glycoproteins for polyubiquitination and degradation. |
---|
PTMs | phosphorylation on Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3SX24|FBX6_BOVIN F-box only protein 6 OS=Bos taurus OX=9913 GN=FBXO6 PE=2 SV=1
MALVSINQLPENILLEVFMHVPARQLLRNCRPVCCLWRDLIDLVSLWKRKCLREGYVTED
WDQPVSDWKVFYFLCSLRRNLLRNPCAEEDMKSWKIDSNGGDQWKVESLPGAHGTGFPDS
KVKKYFVTSYDMCLKSQIIDLKAEGYWEELLDKFRPDIVVKDWFAPRADCGCTYQIRVQL
ASADYLVLASFEPPPVTIHQWNDAKWTEVSHTFSDYPPGVRHIFFQHGGKDTQFWAGWYG
PRVTNSSVVIS*251HRVTRNPPHAMAQP |
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | phosphorylated by CDK1 during mitosis. |
---|
Bibliography | 1.Xu HZ, Wang ZQ, Shan HZ, Zhou L, Yang L, Lei H, Liu B, Wu YL. Overexpression of Fbxo6 inactivates spindle checkpoint by interacting with Mad2 and BubR1. Cell Cycle. 2018;17(24):2779-2789. doi: 10.1080/15384101.2018.1557488. Epub 2018 Dec 18. PMID: 30526252; PMCID: PMC6343701. 2.Chen X, Duan LH, Luo PC, Hu G, Yu X, Liu J, Lu H, Liu B. FBXO6-Mediated Ubiquitination and Degradation of Ero1L Inhibits Endoplasmic Reticulum Stress-Induced Apoptosis. Cell Physiol Biochem. 2016;39(6):2501-2508. doi: 10.1159/000452517. Epub 2016 Nov 14. PMID: 27855403. |