Search by BoMiProt ID - Bomi5725


Primary Information

BoMiProt ID Bomi5725
Protein Name F-box only protein 28
Organism Bos taurus
Uniprot IdQ2NL16
Milk FractionWhey
Ref Sequence Id NP_001039890.1
Aminoacid Length 368
Molecular Weight 41096
Fasta Sequence https://www.uniprot.org/uniprot/Q2NL16.fasta
Gene Name FBXO28
Gene Id 537745
Protein Existence Status Reviewed

Secondary Information

Protein Function Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2NL16|FBX28_BOVIN F-box only protein 28 OS=Bos taurus OX=9913 GN=FBXO28 PE=2 SV=1 MAAASEERMAEEGGGGHGDGGSPSAIASTQRLPPPPPPQPPQPGSQAPPAPALAPDQLPQ NNTLVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQV KAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYRV LRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGS*235PPVPG PS*242AALTTMQLFSKQNPSRQEVTKLQQQVKT*270NGAGVTVLRREISELRTKVQEQQKQLQDQD QKLLEQTQIIGEQNARLAELERKLREVMESAVGNSSGSGQSEES*344PRKRKKAAEAIDSLRK SKRLRNRK
Predicted Disorder Regions 1-61, 125-135, 224-368
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Cdk1-dependent phosphorylation of Fbxo28 is required for efficient ubiquitylation but not degradation of c-MYC by stimulating c-MYC-p300 interactions at target promoters.
Bibliography 1.Kratz, A. S., Richter, K. T., Schlosser, Y. T., Schmitt, M., Shumilov, A., Delecluse, H. J., & Hoffmann, I. (2016). Fbxo28 promotes mitotic progression and regulates topoisomerase IIα-dependent DNA decatenation. Cell cycle (Georgetown, Tex.), 15(24), 3419–3431. https://doi.org/10.1080/15384101.2016.1246093 2.Yu, T., Wang, L., Zhao, C., Qian, B., Yao, C., He, F., Zhu, Y., Cai, M., Li, M., Zhao, D., Zhang, J., Wang, Y., & Qiu, W. (2019). Sublytic C5b-9 induces proliferation of glomerular mesangial cells via ERK5/MZF1/RGC-32 axis activated by FBXO28-TRAF6 complex. Journal of cellular and molecular medicine, 23(8), 5654–5671. https://doi.org/10.1111/jcmm.14473