Search by BoMiProt ID - Bomi5654


Primary Information

BoMiProt ID Bomi5654
Protein Name Extracellular calcium-sensing receptor/Parathyroid cell calcium-sensing receptor
Organism Bos taurus
Uniprot IdP35384
Milk FractionWhey
Ref Sequence Id NP_776427.1
Aminoacid Length 1085
Molecular Weight 121171
Fasta Sequence https://www.uniprot.org/uniprot/P35384.fasta
Gene Name CASR/GPRC2A/PCAR1
Gene Id 281038
Protein Existence Status reviewed

Secondary Information

Protein Function The calcium-sensing receptor has a key role in calcium homeostasis, it is involved in the regulation of the serum calcium level within minutes via the secretion and action of parathyroid and the excretion of calcium in the kidney in a negative feedback manner. 
Biochemical Properties  The dimeric cell surface CaSR, in turn, links to various heterotrimeric and small molecular weight G proteins to regulate intracellular second messengers, lipid kinases, various protein kinases, and transcription factors that are part of the machinery enabling the receptor to modulate the functions of the wide variety of cells in which it is expressed. CaSR signaling is impacted by its interactions with several binding partners in addition to signaling elements per se (i.e., G proteins), including filamin-A and caveolin-1. 
PTMs Disulfide bond formation, Glycosylation at Asn,Phosphorylation at Ser, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P35384|CASR_BOVIN Extracellular calcium-sensing receptor OS=Bos taurus OX=9913 GN=CASR PE=2 SV=1 MALYSCCWILLAFSTWCTSAYGPDQRAQKKGDIILGGLFPIHFGVAVKDQDLKSRPESVE CIRYNFRGFRWLQAMIFAIEEINSSPALLPN*91MTLGYRIFDTCNTVSKALEATLSFVAQNK IDSLNLDEFCN*131CSEHIPSTIAVVGATGSGISTAVANLLGLFYIPQVSYASSSRLLSNKNQ FKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDF SELISQYSDEEKIQQVVEVIQN*262STAKVIVVFSSGPDLEPLIKEIVRRN*288ITGRIWLASEAW ASSSLIAMPEYFHVVGGTIGFGLKAGQIPGFREFLQKVHPRKSVHNGFAKEFWEETFNCH LQEGAKGPLPVDTFLRGHEEGGARLSNSPTAFRPLCTGEEN*401ISSVETPYMDYTHLRISYN VYLAVYSIAHALQDIYTCIPGRGLFTN*447GSCADIKKVEAWQVLKHLRHLN*469FTSNMGEQVTF DECGDLAGN*489YSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINDEKILWSGFSREVPF SN*542CSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACDKCPDDFWSNEN*595HTSCI AKEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRELSYLLLFSLL CCFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKIPTSFHRKWW GLNLQFLLVFLCTFMQIVICAIWLNTAPPSSYRNHELEDEIIFITCHEGSLMALGFLIGY TCLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVI AILAASFGLLACIFFNKVYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRSNVSRQRS SSLGGSTGSTPSSSISSKSNS*921EDPFPQQQPKRQKQPQPLALSPHNAQQPQPRPPSTPQPQ PQSQQPPRCKQKVIFGSGTVTFSLSFDEPQKTAVAHRNSTHQTSLEAQKNNDALTKHQAL LPLQCGETDSELTSQETGLQGPVGEDHQLEMEDPEEMSPALVVSNSRS*1068FVISGGGSTVTE NMLRS
Predicted Disorder Regions 889-1085
DisProt Annotation
TM Helix Prediction 7TMHs ; (616-638), (651-669),(684-706), (726-744), (771-793), (806-828), (840-862)
Significance of PTMs Ubiquitination is performed by RNF19A; which induces proteasomal degradation.
Additional Comments alcium-sensing receptor (CaSR), a widely expressed G-protein-coupled cell surface protein with an important function in bone mineral homeostasis. 
Bibliography 1.Toka HR. New functional aspects of the extracellular calcium-sensing receptor. Curr Opin Nephrol Hypertens. 2014 Jul;23(4):352-60. doi: 10.1097/01.mnh.0000447016.21228.e0. PMID: 24867673; PMCID: PMC4190005. 2.Chakravarti B, Chattopadhyay N, Brown EM. Signaling through the extracellular calcium-sensing receptor (CaSR). Adv Exp Med Biol. 2012;740:103-42. doi: 10.1007/978-94-007-2888-2_5. PMID: 22453940. 3.Raue F, Haag C, Schulze E, Frank-Raue K. The role of the extracellular calcium-sensing receptor in health and disease. Exp Clin Endocrinol Diabetes. 2006 Sep;114(8):397-405. doi: 10.1055/s-2006-924315. PMID: 17039419.