Search by BoMiProt ID - Bomi5648


Primary Information

BoMiProt ID Bomi5648
Protein Name Exportin-2/Chromosome segregation 1-like protein/Importin-alpha re-exporter
Organism Bos taurus
Uniprot IdA5D785
Milk FractionWhey
Ref Sequence Id NP_001014933.2
Aminoacid Length 971
Molecular Weight 110375
Fasta Sequence https://www.uniprot.org/uniprot/A5D785.fasta
Gene Name CSE1L/XPO2
Gene Id 518622
Protein Existence Status reviewed

Secondary Information

Protein Function It is a key regulator of apoptosis, migration and invasion in colorectal cancer as it is associated with viability and apoptosis, cellular adhesion and invasion processes.
Biochemical Properties CSE1L functions as a nuclear transporter like proteins with a nuclear localization signal are transported into the nucleus by the importin-α/β complex. After translocation to the nucleus the importin subunits are displaced and CSE1L binds the free importin-α within the nucleus to mediate its transport back to the cytoplasm thus explaining the subcellular localization of CSE1L to both the nuclear and cytoplasmic compartments.
PTMs Acetylation and Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A5D785|XPO2_BOVIN Exportin-2 OS=Bos taurus OX=9913 GN=CSE1L PE=2 SV=1 MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLEKSQDNVIKV CASVTFKNYIKRNWRIVEDEPNKICEADRVAIKANIVHLMLSSPEQIQKQLS*112DAISIIGR EDFPQKWPDLLTEMVNRFQSGDFHVINGVLRTAHSLFKRYRHEFKSNELWTEIKLVLDAF ALPLTNLFKATIELCSTHANDASALRILFSSLILISKLFYSLNFQDLPEFFEDNMETWMN NFHTLLTLDNKLLQTDDEEEAGLLELLKSQICDNAALYAQKYDEEFQRYLPRFVTAIWNL LVTTGQEVKYDLLVSNAIQFLASVCERPHYKNLFEDQNTLTSICEKVIVPNMEFRAADEE AFEDNSEEYIRRDLEGSDIDTRRRAACDLVRGLCKFFEGPVTGIFSGYVNSMLQEYAKNP SVNWKHKDAAIYLVTSLASKAQTQKHGITQANELVNLTEFFVNHILPDLKSANVNEFPVL KADGIKYITIFRNQVPKEHLLVSIPLLINHLQAESIVVHTYAAHALERLFTMRGPNSATL FTAAEIAPFVEILLTNLFKALTLPGSSENEYIMKAIMRSFSLLQEAIIPYIPTLITQLTQ KLLAVSKNPSKPHFNHYMFEAICLSIRITCKSNPAAVVNFEEALFLVFTEILQNDVQEFI PYVFQVMSLLLETHKNDIPSSYMALFPHLLQPVLWERTGNIPALVRLLQAFLERGSNTIA SAAADKIPGLLGVFQKLIASKANDHQGFYLLNSIIEHMPPESVDQYRKQIFILLFQRLQN SKTTKFIKSFLVFINLYCIKYGALALQEIFDGIQPKMFGMVLEKIIIPEIQKVSGNVEKK ICAVGITKLLTECPPMMDTEYTKLWTPLLQSLIGLFELPEDDTIPDEEHFIDIEDTPGYQ TAFSQLAFAGKKEHDPVGQMVNNPKIHLAQS*931LHKLSTACPGRVPSMVSTSLNAEALQYLQ GYLQAASVTLL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction no TM helices
Additional Comments CSE1L has been found to be over-expressed in several cancer types, including melanoma, lymphoid neoplasms, breast cancers, ovarian carcinomas and liver neoplasms
Bibliography 1.Alnabulsi A, Agouni A, Mitra S, Garcia-Murillas I, Carpenter B, Bird S, Murray GI. Cellular apoptosis susceptibility (chromosome segregation 1-like, CSE1L) gene is a key regulator of apoptosis, migration and invasion in colorectal cancer. J Pathol. 2012 Dec;228(4):471-81. doi: 10.1002/path.4031. Epub 2012 Aug 20. PMID: 22450763. 2.Brinkmann U, Brinkmann E, Gallo M, et al. Cloning and characterization of a cellular apoptosis susceptibility gene, the human homologue to the yeast chromosome segregation gene CAS . Proc Natl Acad Sci USA 1995; 92: 10427–10431. 3.Boni R, Wellmann A, Man YG, et al. Expression of the proliferation and apoptosis-associated CAS protein in benign and malignant cutaneous melanocytic lesions. Am J Dermatopathol 1999; 21: 125–128. 4.Wellmann A, Krenacs L, Fest T, et al. Localization of the cell proliferation and apoptosis-associated CAS protein in lymphoid neoplasms. Am J Pathol 1997; 150: 25–30. 5.Peiro G, Diebold J, Baretton GB, et al. Cellular apoptosis susceptibility gene expression in endometrial carcinoma: correlation with Bcl-2, Bax, and caspase-3 expression and outcome. Int J Gynecol Pathol 2001; 20: 359–367.