Search by BoMiProt ID - Bomi5624


Primary Information

BoMiProt ID Bomi5624
Protein Name Eukaryotic translation initiation factor 3 subunit M
Organism Bos taurus
Uniprot IdQ3T148
Milk FractionExosomes
Ref Sequence Id NP_001030389.2
Aminoacid Length 373
Molecular Weight 42416
Fasta Sequence https://www.uniprot.org/uniprot/Q3T148.fasta
Gene Name EIF3M
Gene Id 515543
Protein Existence Status Reviewed

Secondary Information

Protein Function It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex. The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation.
PTMs Phosphorylation at Ser,N-acetylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T148|EIF3M_BOVIN Eukaryotic translation initiation factor 3 subunit M OS=Bos taurus OX=9913 GN=EIF3M PE=2 SV=2 MS*2VPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDV ESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVR YTVYCSLIKVAASCGAIQYIPTELDQVRKWIS*152DWNLTTEKKHTLLRLLYEALVDCKKSDA ASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDL LTIFVSAKLAYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQEL QIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNL NKVKNS*366LLSLSDT
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Cheshenko N, Trepanier JB, Segarra TJ, Fuller AO, Herold BC. HSV usurps eukaryotic initiation factor 3 subunit M for viral protein translation: novel prevention target. PLoS One. 2010 Jul 27;5(7):e11829. doi: 10.1371/journal.pone.0011829. PMID: 20676407; PMCID: PMC2910742.