Search by BoMiProt ID - Bomi5622


Primary Information

BoMiProt ID Bomi5622
Protein Name Eukaryotic translation initiation factor 3 subunit K/Eukaryotic translation initiation factor 3 subunit 12/eIF-3 p25
Organism Bos taurus
Uniprot IdQ3T0V3
Milk FractionExosomes
Ref Sequence Id NP_001029661.1
Aminoacid Length 218
Molecular Weight 25074
Fasta Sequence https://www.uniprot.org/uniprot/Q3T0V3.fasta
Gene Name EIF3K
Gene Id 515326
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells vertebral column
Protein Function It is aomponent of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex
PTMs N-acetylation at Alanine,Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T0V3|EIF3K_BOVIN Eukaryotic translation initiation factor 3 subunit K OS=Bos taurus OX=9913 GN=EIF3K PE=2 SV=1 MAMFEQMRANVGKLLKGIDRYNPENLAT*28LERYVETQAKENAYDLEANLAVLKLYQFNPAF FQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQA LDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTDSQLKVWMSKYGWS ADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASS*217Q
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments  Individual overexpression of five subunits of human translation initiation factor eIF3 promotes malignant transformation of immortal fibroblast cells.
Bibliography 1.Smith MD, Gu Y, Querol-Audí J, Vogan JM, Nitido A, Cate JH. Human-like eukaryotic translation initiation factor 3 from Neurospora crassa. PLoS One. 2013 Nov 8;8(11):e78715. doi: 10.1371/journal.pone.0078715. PMID: 24250809; PMCID: PMC3826745. 2.Zhang L, Pan X, Hershey JW (2007) Individual overexpression of five subunits of human translation initiation factor eIF3 promotes malignant transformation of immortal fibroblast cells. The Journal of Biological Chemistry 282: 5790–5800.