Search by BoMiProt ID - Bomi5621


Primary Information

BoMiProt ID Bomi5621
Protein Name Eukaryotic translation initiation factor 3 subunit J/Eukaryotic translation initiation factor 3 subunit 1
Organism Bos taurus
Uniprot IdQ0VCU8
Milk FractionExosomes
Ref Sequence Id NP_001069611.1
Aminoacid Length 256
Molecular Weight 28951
Fasta Sequence https://www.uniprot.org/uniprot/Q0VCU8.fasta
Gene Name EIF3J
Gene Id 539052
Protein Existence Status Reviewed

Secondary Information

Protein Function eIF3j is one of the eukaryotic translation factors originally reported as the labile subunit of the eukaryotic translation initiation factor eIF3. 
PTMs Isopeptide bond formation, Phosphorylation at Ser/Thr, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VCU8|EIF3J_BOVIN Eukaryotic translation initiation factor 3 subunit J OS=Bos taurus OX=9913 GN=EIF3J PE=2 SV=1 MAAAAAGDS*9DS*11WDADTFS*18VEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEE AEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLT*107PEEQLADKLRLKK LQEES*125DLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYANFLEA LVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLAD YGGYDGGYAQDY*252EDFM
Predicted Disorder Regions 1-115, 209-234, 242-256
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation is enhanced upon serum stimulation.
Bibliography 1.Egorova T, Biziaev N, Shuvalov A, Sokolova E, Mukba S, Evmenov K, Zotova M, Kushchenko A, Shuvalova E, Alkalaeva E. eIF3j facilitates loading of release factors into the ribosome. Nucleic Acids Res. 2021 Nov 8;49(19):11181-11196. doi: 10.1093/nar/gkab854. PMID: 34591963; PMCID: PMC8565342.