Search by BoMiProt ID - Bomi5620


Primary Information

BoMiProt ID Bomi5620
Protein Name Eukaryotic translation initiation factor 3 subunit I/eIF-3-beta/eIF3 p36
Organism Bos taurus
Uniprot IdQ5E966
Milk FractionWhey
Ref Sequence Id NP_001015628.1
Aminoacid Length 325
Molecular Weight 36473
Fasta Sequence https://www.uniprot.org/uniprot/Q5E966.fasta
Gene Name EIF3I
Gene Id 521747
Protein Existence Status Reviewed

Secondary Information

Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5E966|EIF3I_BOVIN Eukaryotic translation initiation factor 3 subunit I OS=Bos taurus OX=9913 GN=EIF3I PE=2 SV=1 MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQC FVSFFDLRDPSQIDSNEPYMRIPCNDSKITSAVWGPLGECIIAGHEGGELNQYSAKSGEV LVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTT*219LEHQKTFRTERPVNSAALSPN YDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSY SSGGEDGY*308VRIHYFDPQYFEFEFEA
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices