Search by BoMiProt ID - Bomi5618


Primary Information

BoMiProt ID Bomi5618
Protein Name Eukaryotic translation initiation factor 3 subunit D/Eukaryotic translation initiation factor 3 subunit 7/eIF-3-zeta
Organism Bos taurus
Uniprot IdQ3T122
Milk FractionWhey
Ref Sequence Id NP_001029656.1
Aminoacid Length 548
Molecular Weight 63931
Fasta Sequence https://www.uniprot.org/uniprot/Q3T122.fasta
Gene Name EIF3D
Gene Id 515226
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells spermatid 
Protein Function Eukaryotic translation initiation factor 3 subunit D (eIF3D) normally regulates the growth of several types of human cancer cells. 
PTMs N6-acetylation at Lysine,Phosphorylation at Serine
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T122|EIF3D_BOVIN Eukaryotic translation initiation factor 3 subunit D OS=Bos taurus OX=9913 GN=EIF3D PE=2 SV=1 MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYS SQFGGGSQYAYFHEEDETSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQ TLPKSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSS*161VEVRSDWEVKEEMDFPQLM KMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAK TQGNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDKRDNSDFDLLTVSETANEPPQ DEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRY RRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAV IATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQI NLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFS*528S*529DEDDEEEEEEE EEEEEEEA
Predicted Disorder Regions 17-20, 92-96, 122-160, 297-304, 524-548
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments  eIF3D silencing might be a potential therapeutic strategy for leukemia.
Bibliography 1.Liu GZ, Liu JZ, Li XQ, Zhang L, Li SJ, Xiao TW, Wang JX, Li GY, Liu Y. Knockdown of eukaryotic translation initiation factor 3 subunit D (eIF3D) inhibits proliferation of acute myeloid leukemia cells. Mol Cell Biochem. 2018 Jan;438(1-2):191-198. doi: 10.1007/s11010-017-3127-5. Epub 2017 Aug 12. PMID: 28801778.