Search by BoMiProt ID - Bomi5612


Primary Information

BoMiProt ID Bomi5612
Protein Name Eukaryotic translation initiation factor 2 subunit 3/Eukaryotic translation initiation factor 2 subunit gamma
Organism Bos taurus
Uniprot IdQ2KHU8
Milk FractionExosomes
Ref Sequence Id NP_001039582.1
Aminoacid Length 472
Molecular Weight 51065
Fasta Sequence https://www.uniprot.org/uniprot/Q2KHU8.fasta
Gene Name EIF2S3
Gene Id 512350
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells female gonad 
Protein Function IF2 plays an important role in eukaryotic translation, binding GTP through eIF2γ, and initiator methionyl-tRNA (Met-tRNAiMet) to form a stable ternary complex, and identifying the translation initiation site.
Biochemical Properties  EIF2S3 is a protein subunit that contains a GTP-binding pocket.As the core of the heterotrimer, EIF2S3 constitutes the eukaryotic translation initiation factor-2 (eIF2) with the other two subunits, EIF2S1 and EIF2S2.
PTMs N-acetylation at Ala,Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KHU8|IF2G_BOVIN Eukaryotic translation initiation factor 2 subunit 3 OS=Bos taurus OX=9913 GN=EIF2S3 PE=2 SV=1 MAGGEAGVTLGQPHLS*16RQDLATLDVSKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKA ISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGT KGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM KLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGI VSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGA VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments EIF2S3 overexpression may result in a decrease in cellular proliferation, cell cycle arrest, and tumorigenic inhibition via the MAPK/ERK signaling pathway in AML cells.
Bibliography 1.Lu J, Chen S, Tan H, Huang Z, Li B, Liu L, Chen Y, Zeng X, Zou Y, Xu L. Eukaryotic initiation factor-2, gamma subunit, suppresses proliferation and regulates the cell cycle via the MAPK/ERK signaling pathway in acute myeloid leukemia. J Cancer Res Clin Oncol. 2021 Nov;147(11):3157-3168. doi: 10.1007/s00432-021-03712-5. Epub 2021 Jul 7. PMID: 34232382. 2.Hinnebusch AG (2011) Molecular mechanism of scanning and start codon selection in eukaryotes. Microbiol Mol Biol Rev 75(3):434–467. https://doi.org/10.1128/MMBR.00008-11. 3.Young-Baird SK, Shin BS, Dever TE (2019) MEHMO syndrome mutation EIF2S3-I259M impairs initiator Met-tRNAiMet binding to eukaryotic translation initiation factor eIF2. Nucleic Acids Res 47(2):855–867. https://doi.org/10.1093/nar/gky1213. 4.Hinnebusch AG (2014) The scanning mechanism of eukaryotic translation initiation. Annu Rev Biochem 83:779–812. https://doi.org/10.1146/annurev-biochem-060713-035802. 5.Hinnebusch AG, Lorsch JR (2012) The mechanism of eukaryotic translation initiation: new insights and challenges. Cold Spring Harb Perspect Biol. https://doi.org/10.1101/cshperspect.a011544.