Search by BoMiProt ID - Bomi5606


Primary Information

BoMiProt ID Bomi5606
Protein Name Eukaryotic initiation factor 4A-II/ATP-dependent RNA helicase eIF4A-2
Organism Bos taurus
Uniprot IdQ3SZ65
Milk FractionWhey
Ref Sequence Id NP_001029216.1
Aminoacid Length 407
Molecular Weight 46402
Fasta Sequence https://www.uniprot.org/uniprot/Q3SZ65.fasta
Gene Name EIF4A2
Gene Id 286819
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells cerebellum
Protein Function Eukaryotic initiation factor 4A-II (eIF4A2) is an ATP-dependent RNA helicase involved in mRNA translation.
PTMs Phosphorylation at Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SZ65|IF4A2_BOVIN Eukaryotic initiation factor 4A-II OS=Bos taurus OX=9913 GN=EIF4A2 PE=2 SV=1 MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQ QRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKV ILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGT*159PGRVFDMLNRRYLSPKWIKMF VLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKE ELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTV SALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHR IGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI
Predicted Disorder Regions (1-29)
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Abnormal expression of eIF4A2 has been reported as a prognostic factor in different types of cancer. 
Bibliography 1.Lyu S, Lu J, Chen W, Huang W, Huang H, Xi S, Yan S. High expression of eIF4A2 is associated with a poor prognosis in esophageal squamous cell carcinoma. Oncol Lett. 2020 Nov;20(5):177. doi: 10.3892/ol.2020.12038. Epub 2020 Aug 31. PMID: 32934744; PMCID: PMC7471732.