Search by BoMiProt ID - Bomi5503


Primary Information

BoMiProt ID Bomi5503
Protein Name Endoribonuclease LACTB2/Beta-lactamase-like protein 2
Organism Bos taurus
Uniprot IdQ1LZ83
Milk FractionWhey
Ref Sequence Id NP_001069513.1
Aminoacid Length 288
Molecular Weight 32683
Fasta Sequence https://www.uniprot.org/uniprot/Q1LZ83.fasta
Gene Name LACTB2
Gene Id 535021
Protein Existence Status reviewed

Secondary Information

Protein Function Display endoribonuclease activity on ssRNA with a preference for cleavage after purine-pyrimidine sequences.involved in the turnover of mitochondrial RNA, and is essential for mitochondrial function in human cells.
Biochemical Properties Has no activity with double-stranded RNA or DNA.cleaves preferentially 3' to purine-pyrimidine dinucleotide motifs in single-stranded RNA. Binds 2 Zn2+ ions per subunit.
Significance in milk beta lactoglobulin synthesis
PTMs Acetylation,Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1LZ83|LACB2_BOVIN Endoribonuclease LACTB2 OS=Bos taurus OX=9913 GN=LACTB2 PE=2 SV=1 MAATLQRIERLSSRVIRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPSIPEYISCLK QALTEFNTAIQEIIVTHWHRDHTGGIGDICKSINNDTTYCVKKLPRNPERKEIIGNGEQQ YVYVKDGDIIKTEGATLRVVYTPGHTDDHMALVLEEENALFSGDCILGEGTTVFEDLYDY MNSLKELLKIKAKVIYPGHGPVIHNAEAKILQYISHRNIREQQILTVFHENFEKS*235FTAME LVKSIYKDTPEHLHKMAQHNVLLHLKKLEKEGKIVSNTDPEKKWKAHL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Levy S, Allerston CK, Liveanu V, Habib MR, Gileadi O, Schuster G. Identification of LACTB2, a metallo-β-lactamase protein, as a human mitochondrial endoribonuclease. Nucleic Acids Res. 2016 Feb 29;44(4):1813-32. doi: 10.1093/nar/gkw050. Epub 2016 Jan 29. PMID: 26826708; PMCID: PMC4770246.