Search by BoMiProt ID - Bomi5502


Primary Information

BoMiProt ID Bomi5502
Protein Name Endoribonuclease Dicer
Organism Bos taurus
Uniprot IdQ6TUI4
Milk FractionWhey
Ref Sequence Id NP_976235.1
Aminoacid Length 1923
Molecular Weight 218258
Fasta Sequence https://www.uniprot.org/uniprot/Q6TUI4.fasta
Gene Name DICER1
Gene Id 337871
Protein Existence Status reviewed

Secondary Information

Protein Function Plays a crucial role in the biogenesis of small regulatory RNAs, such as microRNAs (miRNAs) and small inter­fering RNAs (siRNAs). 
Biochemical Properties  Dicer's endonuclease role extends beyond the generation of small RNAs; it is also involved in processing additional endogenous and exogenous substrates, and is becoming increasingly implicated in regulating a variety of other cellular processes, outside of its endonuclease function. 
PTMs Phosphorylation of Dicer by ERK localizes it to the nucleus; it remains present during most of oogenesis but is rapidly lost from the terminal oocyte shortly before fertilization
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q6TUI4|DICER_BOVIN Endoribonuclease Dicer OS=Bos taurus OX=9913 GN=DICER1 PE=2 SV=3 MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNT IVCLNTGSGKTFIAVLLTKELSYQIRGDFNRNGKRTVFLVNSANQVAQQVSAVRTHSDLK VGEYSNLEVSASWTKEKWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLA ILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDL VVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISK QILSDCRAVLVVLGPWCADKVAGMMVRELQKHIKHEQEELHRKFLLFTDTFLRKIHALCE EHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWS*413DS*415EDDEE DEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYVMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGEADTEPVVDDDDVFPPYVLRPEDGPRVTINTAIGHVNRYCARLPSDPFTHLAPKCRTRELPDGTFYSTLYLPINSPLRASIVGPPMSCIRLAERVVALICCEKLHKIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRESYPRPGQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFTLSLQMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYSKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSS*1015AEKRK AKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDAGVGVRSLPVDFRYPNLDFGWKKSIDSKSFISIANSSSAENENYCKHSTIVVPENAAHQGANRTSPLENHDQMSVNCRTLFSES*1160PGKLQIEVSTDLTAINGLSYNKSLANGSYDLANRDFCQGN HLNYYKQEIPVQPTTSYPIQNLYNYENQPKPSDECTLLSNKYLDGNANTSTSDGSPVTAA VPGTTETGEAPPDRTASEQSPSPGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGD SFLKHAITTVSLSALILDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVN GLPPGYVVNQDKSNTEKWEKDEMTKDCMLANGKLDDDFEEEEEEEEDLMWRAHKEDADDE DDFLEYDQEHIKFIDNMLMGS*1461GAFVKKIS*1469LS*14711PFSATDSAYEWKMPKKSSLGSLPFSSDFE DFDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSI ADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKAMCPTRENFTSQQKNLSG SRAAASGAGYRASVLKDLEYGCLKIPPRCMFDHPEADRTLRHLISGFENFEKKINYRFKN KAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSAL VNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKE EDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLE MEPEITKFS*1869PAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQV PNS
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Dicer has also been found to participate in the chromosome fragmentation during apoptosis or in the inflammatory processes.
Bibliography 1.Koralewska N, Ciechanowska K, Pokornowska M, Figlerowicz M, Kurzyńska-Kokorniak A. Ludzka rybonukleaza Dicer – struktura i funkcje biologiczne [Human ribonuclease Dicer – structure and functions]. Postepy Biochem. 2019 Oct 1;65(3):173-182. Polish. doi: 10.18388/pb.2019_267. PMID: 31643164. 2.Song MS, Rossi JJ. Molecular mechanisms of Dicer: endonuclease and enzymatic activity. Biochem J. 2017 May 4;474(10):1603-1618. doi: 10.1042/BCJ20160759. PMID: 28473628; PMCID: PMC5415849. 3.Drake, M., Furuta, T., Suen, K.M., Gonzalez, G., Liu, B., Kalia, A. et al. (2014) A requirement for ERK-Dependent Dicer phosphorylation in coordinating oocyte-to-Embryo transition in C. elegans. Dev. Cell 31, 614–628 doi:10.1016/j.devcel.2014.11.004.