Search by BoMiProt ID - Bomi5498


Primary Information

BoMiProt ID Bomi5498
Protein Name Endoplasmic reticulum resident protein 29
Organism Bos taurus
Uniprot IdP81623
Milk FractionWhey
Ref Sequence Id NP_001069739.1
Aminoacid Length 258
Molecular Weight 28806
Fasta Sequence https://www.uniprot.org/uniprot/P81623.fasta
Gene Name ERP29
Gene Id 613357
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells skeletal muscle tissue 
Protein Function Plays an important role in the processing of secretory proteins within the ER.
PTMs Phosphorylation at Tyr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P81623|ERP29_BOVIN Endoplasmic reticulum resident protein 29 OS=Bos taurus OX=9913 GN=ERP29 PE=1 SV=2 MAAAIPRAASLSPLFPLLFLLSAPQDSSGLHTKGALPLDTITFYKVIPKSKFVLVKFDTQ Y*61PY*63GEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKENYPIFYLFQD GDFENPVLYSGAVKVGAIQRWLKGHGIYLGMPGCLPAYDTLAGEFIRASGVEARQSLLKQ GQDNLASVKETDKKWAEQYLKIMGKILDQGEDFPASEMTRITKLIEKNKMSDGKKEELQK SLNILTAFQKKGGEKEEL
Predicted Disorder Regions 187-191, 227-235, 249-258
DisProt Annotation
TM Helix Prediction No TM helices