Search by BoMiProt ID - Bomi5495


Primary Information

BoMiProt ID Bomi5495
Protein Name Endoplasmic reticulum aminopeptidase 2
Organism Bos taurus
Uniprot IdA6QPT7
Milk FractionWhey
Ref Sequence Id NP_001069096.2
Aminoacid Length 954
Molecular Weight 109719
Fasta Sequence https://www.uniprot.org/uniprot/A6QPT7.fasta
Gene Name ERAP2
Gene Id 513572
Protein Existence Status reviewed

Secondary Information

Protein Function Endoplasmic Reticulum Aminopeptidase 2 (ERAP2) trims HLA class I-binding peptides, determining the peptide repertoire presented for immune recognition. Peptide trimming is essential to customize longer precursor peptides to fit them to the correct length required for presentation on MHC class I molecules. hydrolyzes the basic residues Arg and Lys
Biochemical Properties Glycosylation on Asn
PTMs Disulfide bond, Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QPT7|ERAP2_BOVIN Endoplasmic reticulum aminopeptidase 2 OS=Bos taurus OX=9913 GN=ERAP2 PE=2 SV=1 MANSCRKLIFNIYVVFYCSAVIMPQICICSQFTSSPIDQFNKDPKAFPVATNGEIFPWHE LRLPTVVIPLHYDLLIHPN*79LTSLDFVASEKIEVLVRDATQFIILHSKDLEILN*113ASLQSEE DVRYKKPGENLTVLSYPAHQQIALLVPEKLRAHLRYSVAIDFQAKLADGFEGFYKSTYRT LGGETRTIAVTDFEPTEARMAFPCFDEPLFKANFSIKIRRESRHIALSNMPKVKTIELEG GLLEDHFETTVRMSTYLVAYIVCDFTSVSGTASSGVKVSIYASPDKWSQTHYALEASVKL LDFYENYFDIHYPLPKLDLVAIPDFASGAMENWGLITYRETSLLFDPKTSSTSDKLWVTK VIAHELAHQWFGNLVTMEWWNDIWLNEGFARYMELISLN*399ITYPELQFDDSFSNTCFEVIK RDSLNSSHPISNEAKTATQIKEMFDAVSYNKGACILNMLKDFLSEETFRKGIIHYLKKFT YRNAKNDDLWHSLSNNCLEGDSTSGGFCYSDSRKTSNTLAFLRENVELKEMMATWTLQKG IPLVVVKREGRSLRLQQERFLSGVFKEDPEWGTLQERYLWHIPVTYSTSSSQAIHRHILK LKTDTVDLSEKTDWVKFNVDSSGYYIVHYEGQGWDELITLLNQN*644HTLLRPKDRLGLIHDA FQLVSAGRLTLDKALDLTRYLQHETSIPALLKGLEYLELFYRMVERRNISDVTENLKHYL LQYFKPVIDTQSWLDEGSVWDRMLRSTVLKLACYLNHAPCIQKATELFSQWMESSGKLNI PADVLTIVYSVGAQTTAGWNYLLEQYELSLSGAEKNKILYALSTSKHQEKLMKLIELGME GKVIKTQDLATLLFTTARNPKGQQLAWNFVKENWTHLLKKFELGSFPIRMIISGTTSHFS SKDELQEVKLFFESLKAQGSHLDIFQIILETISKNIKWLEKNLPTLRKWLLTSI
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 1TMH;(13-35)
Bibliography Lee ED. Endoplasmic Reticulum Aminopeptidase 2, a common immunological link to adverse pregnancy outcomes and cancer clearance? Placenta. 2017 Aug;56:40-43. doi: 10.1016/j.placenta.2017.03.012. Epub 2017 Mar 18. PMID: 28343731; PMCID: PMC5522626.