Search by BoMiProt ID - Bomi5489


Primary Information

BoMiProt ID Bomi5489
Protein Name Endonuclease/exonuclease/phosphatase family domain-containing protein 1
Organism Bos taurus
Uniprot IdQ3MHJ7
Milk FractionWhey,MFGM
Ref Sequence Id NP_001029581.1
Aminoacid Length 571
Molecular Weight 62787
Fasta Sequence https://www.uniprot.org/uniprot/Q3MHJ7.fasta
Gene Name EEPD1
Gene Id 511767
Protein Existence Status reviewed

Secondary Information

Protein Function Regulates ABCA1 Abundance and Cholesterol Efflux
Biochemical Properties EEPD1 belongs, catalyze cleavage of phosphodiester bonds found in nucleic acids, phospholipids, and perhaps also proteins. Specifically, several members of this family have lipid phosphatase activity, mainly toward inositol phosphates.
Significance in milk Phosphatase acts on aromatic phosphates, casein,and pyrophosphates (both organic and inorganic).
PTMs Phosphorylation on Tyr-15 and Ser-159
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3MHJ7|EEPD1_BOVIN Endonuclease/exonuclease/phosphatase family domain-containing protein 1 OS=Bos taurus OX=9913 GN=EEPD1 PE=2 SV=1 MGSTLGCHRSIPRDPSDLS*16HS*21RKFS*25AACNFSNILVNQERLNINTATEEELMTLPGVTRAV ARSIVEYREYIGGFKKVEDLALVSGVGATKLEQVKFEICVSSKGSS*106AQHS*110PSSLRRDLMA EQQPHHLATAAAVPLTPRVNINTATPAQLMSVRGLTEKMAVS*162IVDYRREHGPFRS*175VEDLV RMGGINAAFLDRIRHQVFAERSRPPSTHTNGGLTFTAKPHPSPTSLSLQSEDLDLPPGGP TQIISTRPSVEAFGGTRDGRPVLRLAT*267WNLQGCSVEKANNPGVREVVCMTLLENSIKLLA VQELLDREALEKFCVELNQPILPNIRKWKGPRGCWKAVVSETPSTQLQKGAGFAGFLWDT AAGVELRDAAWQESSPGNGHGKPVGPSPYLARFKVGSHDLTLVNLHLATLTLPGGENLSK NHSDSHRWAS*432FTQTLQETLKGEKDVIVLGDFGQGPDSSDYDILRKEKFHHLIPAHTFTNI STKNPQGSKALDNIWISKSLKKVFTGHWAVVREGLTNPWIPDNWSWGGVASEHCPVLAEF YTEKDWTRKEGPRSGNGLTLERSEANIKHER
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction no TM helices
Significance of PTMs Phosphorylation at Tyr-15 by ABL1 and FYN, and at Ser-159 is essential for maximal catalytic activity.By contrast, phosphorylation at Thr-14 inhibits activity.
Additional Comments Loss of EEPD1 in several cell types facilitates repair of stressed replication forks induced by DNA-damaging chemicals and that it does so by promoting homologous recombination.
Bibliography 1.Nelson JK, Koenis DS, Scheij S, Cook EC, Moeton M, Santos A, Lobaccaro JA, Baron S, Zelcer N. EEPD1 Is a Novel LXR Target Gene in Macrophages Which Regulates ABCA1 Abundance and Cholesterol Efflux. Arterioscler Thromb Vasc Biol. 2017 Mar;37(3):423-432. doi: 10.1161/ATVBAHA.116.308434. Epub 2017 Jan 12. PMID: 28082258; PMCID: PMC5321112. 2.Wu Y, Lee S-H, Williamson EA, et al. EEPD1 rescues stressed replication forks and maintains genome stability by promoting end resection and homologous recombination repair. PLoS Genet. 2015;11:e1005675.