Search by BoMiProt ID - Bomi5487


Primary Information

BoMiProt ID Bomi5487
Protein Name Endonuclease III-like protein 1/Bifunctional DNA N-glycosylase/DNA-(apurinic or apyrimidinic site) lyase/DNA glycosylase/AP lyase
Organism Bos taurus
Uniprot IdQ2KID2
Milk FractionWhey
Ref Sequence Id NP_001039862.1
Aminoacid Length 305
Molecular Weight 33645
Fasta Sequence https://www.uniprot.org/uniprot/Q2KID2.fasta
Gene Name NTHL1
Gene Id 535203
Protein Existence Status reviewed

Secondary Information

Protein Function DNA glycosylase required for the repair of oxidized bases, such as thymine glycol, within the base excision repair pathway.
PTMs ubl conjugation,Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KID2|NTH_BOVIN Endonuclease III-like protein 1 OS=Bos taurus OX=9913 GN=NTHL1 PE=2 SV=1 MNAAGVRMVVTRARSRGTGASLRRRGEKAAPLRSGEAAAEERKSYSPVKRRRKAQRLSVA YEAS*64EGEGGEGAEHLQAPSWQPQDWRQQLDNIRTMRSGKDAPVDQLGAEHCFDPSASPKV RRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDSTLGALIYPVGFWRSKVK YIKQTSAILQQRYDGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIAN RLRWTKKATKSPEETRRALEEWLPRELWSEINGLLVGFGQQTCLPIRPRCQACLNRALCP AARGL
Predicted Disorder Regions 1-91, 100-109
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs E3 ubiquitin ligase tripartite motif 26 (TRIM26) is targeting NTH1 for polyubiquitylation on lysine 67 present within the N terminus of the protein in vitro.
Bibliography Williams SC, Parsons JL. NTH1 Is a New Target for Ubiquitylation-Dependent Regulation by TRIM26 Required for the Cellular Response to Oxidative Stress. Mol Cell Biol. 2018 May 29;38(12):e00616-17. doi: 10.1128/MCB.00616-17. PMID: 29610152; PMCID: PMC5974432.