Search by BoMiProt ID - Bomi5418


Primary Information

BoMiProt ID Bomi5418
Protein Name EF-hand calcium-binding domain-containing protein 3
Organism Bos taurus
Uniprot IdQ2T9P0
Milk FractionWhey
Ref Sequence Id NP_001033230.1
Aminoacid Length 438
Molecular Weight 50198
Fasta Sequence https://www.uniprot.org/uniprot/Q2T9P0.fasta
Gene Name EFCAB3
Gene Id 524320
Protein Existence Status reviewed

Secondary Information

Protein Function to enable calcium ion binding activity.
PTMs Phosphorylation on Tyr-279
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2T9P0|EFCB3_BOVIN EF-hand calcium-binding domain-containing protein 3 OS=Bos taurus OX=9913 GN=EFCAB3 PE=2 SV=1 MAVSEIKAKFKLNPLTKVPNFHSRRDKDLPGLLPCQLQHKERKLSPSQMRAFQDAYNFFN KDKTGCIDLHGMMCTLAKLGMNLTKHDVHNELRCADIDQDGKVNFSDFLKVLTDKNRFLK AVVPEKGTCLDLAGNPGILLFEILSKLIETSALPKKAISEIVSYFRRKFQETTSGMVWSP DTTGYGKRRFKPDICTPPSSSTAAFANAARIAIMKEKDLFKFLDELKKCNPPSDSPYSKI PIFPLFPNVDGVVMGKPFKDIQKLEMLKRKEPLNFFENY*279FFHKKDWKTQEANIKPVDPTS GYTTDILTIDQMLKRKQNWTVADAAAIKPHVKRATETYNLGIALEHRKQMLNLWRKIRGD LIGIESKNESFYDTFSTYTWSWNVCQELLSPKDLKLYDAHVNRNALHNSVFSSSSDISEC DTDTGRKRKRKGFKGFRQ
Predicted Disorder Regions 412-438
DisProt Annotation
TM Helix Prediction No TM helices