Search by BoMiProt ID - Bomi5411


Primary Information

BoMiProt ID Bomi5411
Protein Name Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
Organism Bos taurus
Uniprot IdA1A4K5
Milk FractionExosomes
Ref Sequence Id NP_001073762.1
Aminoacid Length 888
Molecular Weight 101717
Fasta Sequence https://www.uniprot.org/uniprot/A1A4K5.fasta
Gene Name ENPP2
Gene Id 532663
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells Detected in fetal serum
Protein Function Hydrolyzes lysophospholipids to produce the signaling molecule lysophosphatidic acid (LPA) in extracellular fluids.
Biochemical Properties Binds 2 Zn2+ ions per subunit.Binds 1 Ca2+ ion per subunit.
PTMs Cleavage on pair of basic residues, Disulfide bond formation, Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A1A4K5|ENPP2_BOVIN Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Bos taurus OX=9913 GN=ENPP2 PE=1 SV=1 MARRRSCQLHQVISLFTFAVGVNICLGVTANRIKRAEGWGEGPPTVLSDSPSINISGSCK GRCFELQEAGPPDCRCDNLCKSYSSCCLDFDELCLKTAGGWECTKDRCGEVRNEDHACHC SEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKTPECPAGFVRPPLIIFSVDGFRASYMK KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA HFNLRGREKFNHRWWGGQPLWITATKQGVIAGTFFWPVVIPHERRILTILQWLTLPDHER PSVYAFYSEQPDFSGHKYGPFGPEMTNPLRDIDKTVGQLMDGLKQLKLHRCVNVIFVGDH GMEDVTCDRTEFLSNYLTNVDDIILVPGTLGRIRPKFNNHAKYDPKVIIAN*411LTCKKPDQH FKPYLKQHLPKRLHYANNRRIEDVHLLVERRWHVARKPLEVYKKPSGKCFFQGDHGFDNK VNSMQTVFVGYGPTFKYKTKVPPFENIELYNVMCDLLGLKPAPNN*525GTHGSLNHLLRTNTF RPTVPEEVTRPNYPGVMYLQSDFDLGCTCDDKAEPKNKLDELNKHLHIKESTEAETRKFR GSKNEIKENVNGNFEPRKERHLLYGRPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYT VSKQADVSDIPAHLTNCVRPDVRVSPSFSQSCLAYKNDKQMSYGFLFPPYLSSSPEAKYD AFLVTNMVPMYPAFKRIWNYFQRVLVKKYASERNGVNVISGPIFDYDYDGLHDTQDKIKQ YVEGSSVPVPTHYYSILTSCLDFTQPADRCDGPLSVSAFVLPHRPDNDESCN*832SSEDESKW VEELLKMHTARVRDIEHLTSLDFFRKTSRSYPEILTLKTYLQTYESEI
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 1TMH;(12-30)