Search by BoMiProt ID - Bomi5388


Primary Information

BoMiProt ID Bomi5388
Protein Name E3 ubiquitin-protein transferase MAEA/Macrophage erythroblast attacher
Organism Bos taurus
Uniprot IdQ3MHJ2
Milk FractionWhey
Ref Sequence Id NP_001029587.1
Aminoacid Length 434
Molecular Weight 49396
Fasta Sequence https://www.uniprot.org/uniprot/Q3MHJ2.fasta
Gene Name MAEA
Gene Id 511956
Protein Existence Status reviewed

Secondary Information

Protein Function is an E3 ubiquitin ligase promoting autophagy and maintenance of haematopoietic stem cells.
Biochemical Properties RING domain which mediate direct transfer of ubiquitin to the substrate from the E2. RING domains coordinate two Zn2+ ions in a cross braced arrangement critical for its structure, or without Zn2+ coordination in the case of the U-box family of E3 ligases in which case polar and charged residues substitute for the Zn2+ ions.
PTMs phosphorylation,Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3MHJ2|MAEA_BOVIN E3 ubiquitin-protein transferase MAEA OS=Bos taurus OX=9913 GN=MAEA PE=2 SV=1 MAVQESAAQLSMTLKVQEYPTLKVPYET*28LNKRFRAAQKNIDRETSHVTMVVAELEKTLSG CPAVDSVVSLLDGVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVW KRKRMDRMMVEHLLRCGYYNTAVKLARQSGIEDLVNIEMFLTAKEVEESLERRETATCLA WCHDNKSRLRKMKGRQSEHDAKTGRKSRVASGSPKESEDLGMETIKGKPELSCLEFSLRI QEFIELIRQNKRLDAVRHARKHFSQAEGSQLDEVRQVMGMLAFPPDTHISPYKDLLDPAR WRMLIQQFRYDNYRLHQLGNSSVFTLTLQAGLSAIKTPQCYKEDGSSRSPDCPVCSRSLN KLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYVYGYNSLLSIRQDDKVVCPRTK EVFHFSQAEKVYIM
Predicted Disorder Regions 190-223
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Autoubiquitinated as component of the CTLH E3 ubiquitin-protein ligase complex
Additional Comments MAEA overexpression in hepatocytes resulted in the reduction of the expression levels of gluconeogenesis genes, glucokinase and HNF-4α.
Bibliography 1.Maitland MER, Onea G, Chiasson CA, Wang X, Ma J, Moor SE, Barber KR, Lajoie GA, Shaw GS, Schild-Poulter C. The mammalian CTLH complex is an E3 ubiquitin ligase that targets its subunit muskelin for degradation. Sci Rep. 2019 Jul 8;9(1):9864. doi: 10.1038/s41598-019-46279-5. PMID: 31285494; PMCID: PMC6614414. 2.Wei, Q., Pinho, S., Dong, S. et al. MAEA is an E3 ubiquitin ligase promoting autophagy and maintenance of haematopoietic stem cells. Nat Commun 12, 2522 (2021). https://doi.org/10.1038/s41467-021-22749-1