Primary Information |
---|
BoMiProt ID | Bomi5388 |
---|
Protein Name | E3 ubiquitin-protein transferase MAEA/Macrophage erythroblast attacher |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q3MHJ2 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001029587.1 |
---|
Aminoacid Length | 434 |
---|
Molecular Weight | 49396 |
---|
FASTA Sequence |
Download |
---|
Gene Name | MAEA |
---|
Gene ID | 511956 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | is an E3 ubiquitin ligase promoting autophagy and maintenance of haematopoietic stem cells. |
---|
Biochemical Properties | RING domain which mediate direct transfer of ubiquitin to the substrate from the E2. RING domains coordinate two Zn2+ ions in a cross braced arrangement critical for its structure, or without Zn2+ coordination in the case of the U-box family of E3 ligases in which case polar and charged residues substitute for the Zn2+ ions. |
---|
PTMs | phosphorylation,Ubl conjugation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3MHJ2|MAEA_BOVIN E3 ubiquitin-protein transferase MAEA OS=Bos taurus OX=9913 GN=MAEA PE=2 SV=1
MAVQESAAQLSMTLKVQEYPTLKVPYET*28LNKRFRAAQKNIDRETSHVTMVVAELEKTLSG
CPAVDSVVSLLDGVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVW
KRKRMDRMMVEHLLRCGYYNTAVKLARQSGIEDLVNIEMFLTAKEVEESLERRETATCLA
WCHDNKSRLRKMKGRQSEHDAKTGRKSRVASGSPKESEDLGMETIKGKPELSCLEFSLRI
QEFIELIRQNKRLDAVRHARKHFSQAEGSQLDEVRQVMGMLAFPPDTHISPYKDLLDPAR
WRMLIQQFRYDNYRLHQLGNSSVFTLTLQAGLSAIKTPQCYKEDGSSRSPDCPVCSRSLN
KLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYVYGYNSLLSIRQDDKVVCPRTK
EVFHFSQAEKVYIM |
---|
Predicted Disorder Regions | 190-223 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | Autoubiquitinated as component of the CTLH E3 ubiquitin-protein ligase complex |
---|
Additional Comments | MAEA overexpression in hepatocytes resulted in the reduction of the expression levels of gluconeogenesis genes, glucokinase and HNF-4α. |
---|
Bibliography | 1.Maitland MER, Onea G, Chiasson CA, Wang X, Ma J, Moor SE, Barber KR, Lajoie GA, Shaw GS, Schild-Poulter C. The mammalian CTLH complex is an E3 ubiquitin ligase that targets its subunit muskelin for degradation. Sci Rep. 2019 Jul 8;9(1):9864. doi: 10.1038/s41598-019-46279-5. PMID: 31285494; PMCID: PMC6614414. 2.Wei, Q., Pinho, S., Dong, S. et al. MAEA is an E3 ubiquitin ligase promoting autophagy and maintenance of haematopoietic stem cells. Nat Commun 12, 2522 (2021). https://doi.org/10.1038/s41467-021-22749-1 |