Search by BoMiProt ID - Bomi5386


Primary Information

BoMiProt ID Bomi5386
Protein Name E3 ubiquitin-protein ligase TRIM56/RING-type E3 ubiquitin transferase TRIM56/Tripartite motif-containing protein 56
Organism Bos taurus
Uniprot IdE1BD59
Milk FractionWhey
Aminoacid Length 732
Molecular Weight 79152
Fasta Sequence https://www.uniprot.org/uniprot/E1BD59.fasta
Gene Name TRIM56
Protein Existence Status reviewed

Secondary Information

Protein Function E3 ubiquitin-protein ligase that plays a key role in innate antiviral immunity. TRIM56 E3 ligase does monoubiquitination of cGAS on Lys-335,which is important for cytosolic DNA sensing and IFNα,IFNβ production to induce anti-DNA viral immunity.an essential component of the TLR3 antiviral signaling pathway .TRIM56 associates with and promotes the ubiquitination (K63 linked ubl conjugation) of stimulator of IFN genes (STING), an innate immune signaling adaptor residing in the endoplasmic reticulum (ER), thereby enhancing cytosolic dsDNA-induced IFN production.
Biochemical Properties has intrinsic E3 ubiquitin ligase activity that lies in the N-terminal RING domain. C-terminal structural integrity of TRIM56 is critical for mediating protein-protein interaction, also it controls the ability of TRIM56 to promote TLR3 signaling.
PTMs Phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|E1BD59|TRI56_BOVIN E3 ubiquitin-protein ligase TRIM56 OS=Bos taurus OX=9913 GN=TRIM56 PE=2 SV=1 MVSQGSSPSLLEALSSDFLACKICLEQLRVPKTLPCLHTYCQDCLAQLAEGSRLRCPECR ESVPVPPAGVAAFKTNFFVNGLLDLVKARAGGDLRAGKPACALCPLMGGASAGGPATARC LDCADDLCQACADGHRCTRQTHSHRVVDLVGYRAGWYDEEARERQAAQCPQHPGEALRFL CQPCSQLLCRECRLDPHLDHPCLPLAEAVRARRPGLEELLAGVDNNLAELEATRLAEKEA LARLREQAAKVVTQVEEASERVLRALLAQKQEVLGQLRAHVEAAEEGARERLGELEGQEQ VAREAAAFARRVLSLGREAEILSLEGAIAQRLRQLQGCPWVPGPAPCQLPQLELYPGLLD KNCHLLRLSFEEQLPQKDSGKDGARSQGGDATQPQSRDGVQT*402PNQEDGAKTPKESRAQT*419P QEDGGTQARVGSRSNKKRKFKGRLKSVSREPS*452PAPGPNLEGSGLLPRPIFFCSFPTRMPG DKRAPRITGLCPFGSREILVADEQNRALKRFSLNGDYRGAVPVPEGCSPCSVAALQDTVA FSAAARLYLINHNGEVQWRRALSLCQASHAVAAMPSGDRVAVSVSGHVEVYNMEGSLATR FIPGGKANRGLRALVFLTTSPQGHFVGSDWQQNSLVVCDGLGQVVGEYRGPGLHGCQPGS VSVDKKGYIFLTLREVNKVVILDPKGSLLGDFLTAYHGLEKPRVTTMVDGRYLVVSLSNG TIHVFRVRPLDS
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Seo GJ, Kim C, Shin WJ, Sklan EH, Eoh H, Jung JU. TRIM56-mediated monoubiquitination of cGAS for cytosolic DNA sensing. Nat Commun. 2018 Feb 9;9(1):613. doi: 10.1038/s41467-018-02936-3. PMID: 29426904; PMCID: PMC5807518. 2.Shen Y, Li NL, Wang J, Liu B, Lester S, Li K. TRIM56 is an essential component of the TLR3 antiviral signaling pathway. J Biol Chem. 2012 Oct 19;287(43):36404-13. doi: 10.1074/jbc.M112.397075. Epub 2012 Sep 4. PMID: 22948160; PMCID: PMC3476306.