Primary Information |
---|
BoMiProt ID | Bomi5385 |
---|
Protein Name | E3 ubiquitin-protein ligase TRIM11/RING-type E3 ubiquitin transferase TRIM11/Tripartite motif-containing protein 11 |
---|
Organism | Bos taurus |
---|
Uniprot Id | A0JN74 |
---|
Milk Fraction | Whey,MFGM |
---|
Ref Sequence Id | NP_001071388.1 |
---|
Aminoacid Length | 468 |
---|
Molecular Weight | 52947 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/A0JN74.fasta |
---|
Gene Name | TRIM11 |
---|
Gene Id | 514580 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | TRIM11 binds to both the proteasome and USP14, a deubiquitinase that prematurely removes ubiquitins from proteasome-bound substrates and also noncatalytically inhibits the proteasome, and precludes their association, thereby increasing proteasome activity.enhances degradation of aberrant and normal regulatory proteins, and augments overall rate of proteolysis. |
---|
Biochemical Properties | characterized by an N-terminal TRIM/RBCC motif comprising a RING domain, one or two B-Boxes, and a predicted coiled-coil region, which is followed by a more diverse C-terminal region. RING domain is required for interaction with USP14.composed of a C-terminal PRY-SPRY (PS) motif. |
---|
PTMs | phosphorylation on Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A0JN74|TRI11_BOVIN E3 ubiquitin-protein ligase TRIM11 OS=Bos taurus OX=9913 GN=TRIM11 PE=2 SV=1
MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELF
PQRNLRPNRPLAKMAEMARRLHPPS*85PVPQGVCAAHREPLAAFCGDELRLLCAACERSGEH
WAHRVRPLQDAAEDLKSKLEKSLEHLRKQMEDALLFQAQAEETCSLWQKMVETQRQNVLT
EFERLRRLLVEEEQLLLQRLEEEELEVLPPLRESAARLGQQSAQLAELITELEGRCQLPA
LGLLQDIRDTLRRVQDVKLQPPEVVPMEMRTVCRVPGLVEALRRFRGDMTLDPDTANPEL
VLSEDRRSVRRGDLRQALPDSPERFDPGPCVLGREPLTSGRHYWEVEVGERASWALGVCR
ENANRKEKGELFAGNGFWILVFLGSYYNSSERAFAPLRDPPRRVGIFLDYEAGHLSFYSA
NDGSLLYTFPETPFSGTLRALFSPLSSSPTPMTICRLKGGPGDGLAPQ |
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | no TM helices |
---|
Additional Comments | promotes cell survival and is upregulated upon heat shock.upregulation of TRIM11 and other TRIMs may contribute to an enhanced cellular capacity to remove misfolded proteins in tumor cell. |
---|
Bibliography | Chen L, Zhu G, Johns EM, Yang X. TRIM11 activates the proteasome and promotes overall protein degradation by regulating USP14. Nat Commun. 2018 Mar 26;9(1):1223. doi: 10.1038/s41467-018-03499-z. PMID: 29581427; PMCID: PMC5964324. |