Primary Information |
---|
BoMiProt ID | Bomi5378 |
---|
Protein Name | E3 ubiquitin-protein ligase RNF8/RING finger protein 8/RING-type E3 ubiquitin transferase RNF8 |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q2HJ46 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001039681.1 |
---|
Aminoacid Length | 487 |
---|
Molecular Weight | 55729 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q2HJ46.fasta |
---|
Gene Name | RNF8 |
---|
Gene Id | 515933 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | The ubiquitin ligase RNF8 is known to induce epithelial-to-mesenchymal (EMT) transition and metastasis in triple-negative breast cancer (TNBC). Besides EMT, Rho GTPases have been shown as key regulators in metastasis. |
---|
Biochemical Properties | The E3 ligase RNF8 ubiquitylates histone H1 at DSB flanking sites, triggering an orchestrated recruitment of signaling and repair proteins (e.g., the breast cancer susceptibility protein BRCA1) to facilitate the repair of the break sites |
---|
PTMs | Phosphorylation at Serine |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2HJ46|RNF8_BOVIN E3 ubiquitin-protein ligase RNF8 OS=Bos taurus OX=9913 GN=RNF8 PE=2 SV=1
MGDPGSLVTEGRAGERSWCLRRVGMNTEWLLLEDGNEVTVGRGFGVTYQLVSKICPLMIS
RNHCILKQNAEGQWTIKDNKSLNGVWLNRERLEPLKVYSIHKGDHIQLGVPLENKENAEY
EYEVTEEDWERIYPCLSPKSDQMMEKNKGLRTKRKFS*157LDELEGSGAEGPSNLKSKISKLS
CEPGQQVKSHGKGKVASQPSEYLDPKLTSFEPSVKTTGAHVNPGPAKVIELLRKKKKASN
PSASQSSLELFKVTMSRILMLKTQMQEKQVAVLNVKKQTKKGSSKKIVKMEQELQDLQSQ
LCAEQAQQQARVEQLEKTIQEEQQHLEGLEKEEGEEDLKQQLAQALQEYRSLVEELNRSK
KNFEAIIQAKDKELEQTKEEKEKVQAQKEEVLSHMNDVLENELQCIICSEYFVEAVTLNC
AHSFCSYCINEWMKRKVECPICRKDIKSKTRSLVLDNCISKMVDNLNSEVKERRIVLIRE
RKGKRLF |
---|
Predicted Disorder Regions | 4-11, 137-246, 276-338 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | no TM helices |
---|
Significance of PTMs | Autoubiquitination on Lys-48 and 63 of ubiquitin.Polyubiquitination at Lys-29 is also observed, but it doesn't require its own functional RING-type zinc finger. |
---|
Additional Comments | The E3 ubiquitin ligase RNF8 plays critical roles in maintaining genomic stability by promoting the repair of DNA double-strand breaks (DSBs) through ubiquitin signaling. Abnormal activation of Notch signaling and defective repair of DSBs promote breast cancer risk. |
---|
Bibliography | 1.Pereira De Carvalho B, Chern YJ, He J, Chan CH. The ubiquitin ligase RNF8 regulates Rho GTPases and promotes cytoskeletal changes and motility in triple-negative breast cancer cells. FEBS Lett. 2021 Jan;595(2):241-252. doi: 10.1002/1873-3468.13999. Epub 2020 Dec 5. PMID: 33205415; PMCID: PMC7898409. 2.RNF8 transduces the DNA-damage signal via histone ubiquitylation and checkpoint protein assembly.
Huen MS, Grant R, Manke I, Minn K, Yu X, Yaffe MB, Chen J
Cell. 2007 Nov 30; 131(5):901-14. 3.Histone H1 couples initiation and amplification of ubiquitin signalling after DNA damage.
Thorslund T, Ripplinger A, Hoffmann S, Wild T, Uckelmann M, Villumsen B, Narita T, Sixma TK, Choudhary C, Bekker-Jensen S, Mailand N
Nature. 2015 Nov 19; 527(7578):389-93. |