Search by BoMiProt ID - Bomi5367


Primary Information

BoMiProt ID Bomi5367
Protein Name E3 ubiquitin-protein ligase KCMF1/RING-type E3 ubiquitin transferase KCMF1
Organism Bos taurus
Uniprot IdQ1LZE1
Milk FractionWhey
Ref Sequence Id NP_001069743.1
Aminoacid Length 381
Molecular Weight 41947
Fasta Sequence https://www.uniprot.org/uniprot/Q1LZE1.fasta
Gene Name KCMF1
Gene Id 613522
Protein Existence Status reviewed

Secondary Information

Protein Function  KCMF1 acts as a potential metastasis suppressor protein downregulated by high constitutive CD99 expression in ESFT.
Biochemical Properties KCMF1 represents an evolutionarily highly conserved protein with a 95% identity between human and zebrafish. 
PTMs Acetrylation and Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1LZE1|KCMF1_BOVIN E3 ubiquitin-protein ligase KCMF1 OS=Bos taurus OX=9913 GN=KCMF1 PE=2 SV=1 MS*2RHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVD FDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGD PNHVTDDFAAHLTLEHRAPRDLDESSGVRHVRRMFHPGRGLGGPRARRS*169NMHFTSSSTGG LSSSQSSYS*189PSNREAMDPIAELLSQLSGVRRS*212AGGQLNSSGPSASQLQQLQMQLQLERQH AQAARQQLETARNATRRTNTSSVTTTITQSTATTNTANTESSQQTIQNSQFLLTRLNDPK MSETERQSMESERADRSLFVQELLLSTLVREESSS*335S*336DEDERGEMADFGAMGCVDIMPLDV ALENLNLKESNKGNEPPPPPL
Predicted Disorder Regions 96-101, 139-381
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments KCMF1 is overexpressed during pancreatic cancer development and downregulation of KCMF1 inhibits pancreatic cancer development in mice.y. KCMF1 and 14-3-3σ protein may affect the proliferation and colony formation of human colon cancer stem cells.
Bibliography 1.Kreppel M, Aryee DN, Schaefer KL, Amann G, Kofler R, Poremba C, Kovar H. Suppression of KCMF1 by constitutive high CD99 expression is involved in the migratory ability of Ewing's sarcoma cells. Oncogene. 2006 May 4;25(19):2795-800. doi: 10.1038/sj.onc.1209300. PMID: 16314831. 2.Beilke S, Oswald F, Genze F, Wirth T, Adler G, Wagner M. The zinc-finger protein KCMF1 is overexpressed during pancreatic cancer development and downregulation of KCMF1 inhibits pancreatic cancer development in mice. Oncogene. 2010 Jul 15;29(28):4058-67. doi: 10.1038/onc.2010.156. Epub 2010 May 17. PMID: 20473331.