Primary Information |
---|
BoMiProt ID | Bomi5367 |
---|
Protein Name | E3 ubiquitin-protein ligase KCMF1/RING-type E3 ubiquitin transferase KCMF1 |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q1LZE1 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001069743.1 |
---|
Aminoacid Length | 381 |
---|
Molecular Weight | 41947 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q1LZE1.fasta |
---|
Gene Name | KCMF1 |
---|
Gene Id | 613522 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | KCMF1 acts as a potential metastasis suppressor protein downregulated by high constitutive CD99 expression in ESFT. |
---|
Biochemical Properties | KCMF1 represents an evolutionarily highly conserved protein with a 95% identity between human and zebrafish. |
---|
PTMs | Acetrylation and Phosphorylation at Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q1LZE1|KCMF1_BOVIN E3 ubiquitin-protein ligase KCMF1 OS=Bos taurus OX=9913 GN=KCMF1 PE=2 SV=1
MS*2RHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVD
FDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGD
PNHVTDDFAAHLTLEHRAPRDLDESSGVRHVRRMFHPGRGLGGPRARRS*169NMHFTSSSTGG
LSSSQSSYS*189PSNREAMDPIAELLSQLSGVRRS*212AGGQLNSSGPSASQLQQLQMQLQLERQH
AQAARQQLETARNATRRTNTSSVTTTITQSTATTNTANTESSQQTIQNSQFLLTRLNDPK
MSETERQSMESERADRSLFVQELLLSTLVREESSS*335S*336DEDERGEMADFGAMGCVDIMPLDV
ALENLNLKESNKGNEPPPPPL |
---|
Predicted Disorder Regions | 96-101, 139-381 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | KCMF1 is overexpressed during pancreatic cancer development and downregulation of KCMF1 inhibits pancreatic cancer development in mice.y. KCMF1 and 14-3-3σ protein may affect
the proliferation and colony formation of human colon cancer stem cells. |
---|
Bibliography | 1.Kreppel M, Aryee DN, Schaefer KL, Amann G, Kofler R, Poremba C, Kovar H. Suppression of KCMF1 by constitutive high CD99 expression is involved in the migratory ability of Ewing's sarcoma cells. Oncogene. 2006 May 4;25(19):2795-800. doi: 10.1038/sj.onc.1209300. PMID: 16314831. 2.Beilke S, Oswald F, Genze F, Wirth T, Adler G, Wagner M. The zinc-finger protein KCMF1 is overexpressed during pancreatic cancer development and downregulation of KCMF1 inhibits pancreatic cancer development in mice. Oncogene. 2010 Jul 15;29(28):4058-67. doi: 10.1038/onc.2010.156. Epub 2010 May 17. PMID: 20473331. |