Search by BoMiProt ID - Bomi5307


Primary Information

BoMiProt ID Bomi5307
Protein Name Dynamin-1
Organism Bos taurus
Uniprot IdQ08DF4
Milk FractionWhey
Ref Sequence Id NP_001070288.1
Aminoacid Length 856
Molecular Weight 96252
Fasta Sequence https://www.uniprot.org/uniprot/Q08DF4.fasta
Gene Name DNM1
Gene Id 508794
Protein Existence Status reviewed

Secondary Information

Protein Function Dynamin 1 supports the microtubule bundle formation and participates in the stabilization of microtubules.
Biochemical Properties Dynamins 1-3 contain an N-terminal GTPase, a bundle signaling element, a stalk domain, a phosphoinositide-binding pleckstrin homology domain, and a C-terminal proline and arginine-rich domain.
Significance in milk microtubule-binding protein with possible microtubule-based motor activity.
PTMs Phosphorylation at Ser 857,Nitration,Methylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08DF4|DYN1_BOVIN Dynamin-1 OS=Bos taurus OX=9913 GN=DNM1 PE=2 SV=1 MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG SGIVTRRPLVLQLVNATTEY*80AEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPI NLRVY*125SPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLS*306IEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGS*347GDQIDTY*354ELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTATIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKAS*512GNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPTGRRS*774PTSS*778PTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGAS*822PDPFGPPPQVPSRPNRAPPGVPSQPIGSGKSIPS
Predicted Disorder Regions 636-649, 742-781, 821-856
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs mediate synaptic transmission through interactions with multiple endocytic accessory proteins
Additional Comments Dynamin 1 is expressed mainly in the brain, whereas dynamin 2 is expressed ubiquitously, and dynamin 3 is localized to the brain, lung and testis.
Bibliography 1.La TM, Tachibana H, Li SA, Abe T, Seiriki S, Nagaoka H, Takashima E, Takeda T, Ogawa D, Makino SI, Asanuma K, Watanabe M, Tian X, Ishibe S, Sakane A, Sasaki T, Wada J, Takei K, Yamada H. Dynamin 1 is important for microtubule organization and stabilization in glomerular podocytes. FASEB J. 2020 Dec;34(12):16449-16463. doi: 10.1096/fj.202001240RR. Epub 2020 Oct 17. PMID: 33070431. 2.Nakata T, Takemura R, Hirokawa N. A novel member of the dynamin family of GTP-binding proteins is expressed specifically in the testis. J Cell Sci. 1993;105:1-5. 3.Faelber K, Posor Y, Gao S, et al. Crystal structure of nucleotide-free dynamin. Nature. 2011;477:556-560. 3.. Ford MG, Jennim S, Nunnari J. The crystal structure of dynamin. Nature. 2011;477:561-566. 4.Wen Xie, Tatyana Adayev, Huiyuan Zhu, Jerzy Wegiel, Andrzej Wieraszko, and Yu-Wen Hwang Biochemistry 2012 51 (34), 6786-6796 DOI: 10.1021/bi2017798.