Search by BoMiProt ID - Bomi5304


Primary Information

BoMiProt ID Bomi5304
Protein Name Dynactin subunit 6
Organism Bos taurus
Uniprot IdQ148G7
Milk FractionExosomes
Ref Sequence Id NP_001069106.1
Aminoacid Length 190
Molecular Weight 20675
Fasta Sequence https://www.uniprot.org/uniprot/Q148G7.fasta
Gene Name DCTN6
Gene Id 513751
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells  testis
Protein Function Dynactin subunit 6 (DCTN6) (a component of the cell dynactin complex), as a specific binding partner for E2,a protein in classical swine fever (CSF) virus (CSFV) is the major virus structural glycoprotein and is an essential component of the viral particle.
PTMs Phosphorylation at Thr-186
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q148G7|DCTN6_BOVIN Dynactin subunit 6 OS=Bos taurus OX=9913 GN=DCTN6 PE=2 SV=1 MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQA LIINAHPDNITPDAEDPEPKPMIIGTNNVFEVGCYCQAMKIGDNNVIESKAYVGRNVILT SGCIIGACCNLNTFEVIPENTVIYGGDCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKT MKGSST*186PVKN
Predicted Disorder Regions 1-8, 67-79, 176-190
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation by CDK1 during mitotic prometaphase creates a binding site for PLK1 that facilitates its recruitment to kinetochores.
Bibliography 1.Borca MV, Vuono EA, Ramirez-Medina E, Azzinaro P, Berggren KA, Singer M, Rai A, Pruitt S, Silva EB, Velazquez-Salinas L, Carrillo C, Gladue DP. Structural Glycoprotein E2 of Classical Swine Fever Virus Interacts with Host Protein Dynactin Subunit 6 (DCTN6) during the Virus Infectious Cycle. J Virol. 2019 Dec 12;94(1):e01642-19. doi: 10.1128/JVI.01642-19. PMID: 31597779; PMCID: PMC6912105.