Search by BoMiProt ID - Bomi5264


Primary Information

BoMiProt ID Bomi5264
Protein Name Dopamine beta-hydroxylase
Organism Bos taurus
Uniprot IdP15101
Milk FractionWhey,MFGM
Ref Sequence Id NP_851338.1
Aminoacid Length 610
Molecular Weight 68141
Fasta Sequence https://www.uniprot.org/uniprot/P15101.fasta
Gene Name DBH
Gene Id 280758
Protein Existence Status reviewed

Secondary Information

Protein Function Dopamine β hydroxylase (DBH), a key player in the catecholamine biosynthetic pathway, may provide a therapeutic opportunity and should be extensively explored as a target for potent anti-hypertensives.
Biochemical Properties d dopamine β-hydroxylase (DBH), which converts dopamine to noradrenaline; these enzymes are the main enzymes responsible for catecholamine synthesis.
PTMs N-Linked Glycosylation at Asn and Proteolytic clevage
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P15101|DOPO_BOVIN Dopamine beta-hydroxylase OS=Bos taurus OX=9913 GN=DBH PE=1 SV=2 MQVPSPSVREAASMYGTAVAVFLVILVAALQGSAPAESPFPFHIPLDPEGTLELSWNISY AQETIYFQLLVRELKAGVLFGMSDRGELENADLVVLWTDRDGAYFGDAWSDQKGQVHLDS QQDYQLLRAQRTPEGLYLLFKRPFGTCDPNDYLIEDGTVHLVYGFLEEPLRSLESIN*177TSG LHTGLQRVQLLKPSIPKPALPADTRTMEIRAPDVLIPGQQTTYWCYVTELPDGFPRHHIV MYEPIVTEGNEALVHHMEVFQCAAEFETIPHFSGPCDSKMKPQRLNFCRHVLAAWALGAK AFYYPEEAGLAFGGPGSSRFLRLEVHYHNPLVITGRRDSSGIRLYYTAALRRFDAGIMEL GLAYTPVMAIPPQETAFVLTGYCTDKCTQLALPASGIHIFASQLHTHLTGRKVVTVLARD GRETEIVNRDNHYSPHFQEIRMLKKVVSVQPGDVLITSCTYNTEDRRLATVGGFGILEEM CVNYVHYYPQTQLELCKSAVDPGFLHKYFRLVNRFNSEEVCTCPQASVPEQFASVPWNSF NREVLKALYGFAPISMHCN*559RSSAVRFQGEWNRQPLPEIVSRLEEPTPHCPASQAQSPAGP TVLNISGGKG
Predicted Disorder Regions 578-610
DisProt Annotation
TM Helix Prediction 1TMH; (12-34)
Significance of PTMs Proteolytic cleavage after the membrane-anchor leads to the release of the soluble form.
Additional Comments An Essential and Optimal Immunohistochemical Marker for Pheochromocytoma and Sympathetic Paraganglioma
Bibliography 1.Kimura N. Dopamine β-hydroxylase: An Essential and Optimal Immunohistochemical Marker for Pheochromocytoma and Sympathetic Paraganglioma. Endocr Pathol. 2021 Jun;32(2):258-261. doi: 10.1007/s12022-020-09655-w. Epub 2021 Jan 6. PMID: 33405069. 2.Dey SK, Saini M, Prabhakar P, Kundu S. Dopamine β hydroxylase as a potential drug target to combat hypertension. Expert Opin Investig Drugs. 2020 Sep;29(9):1043-1057. doi: 10.1080/13543784.2020.1795830. Epub 2020 Aug 4. PMID: 32658551. 3.Robertson JG, Desai PR, Kumar A, Farrington GK, Fitzpatrick PF, Villafranca JJ. Primary amino acid sequence of bovine dopamine beta-hydroxylase. J Biol Chem. 1990 Jan 15;265(2):1029-35. PMID: 2295597.