Search by BoMiProt ID - Bomi5239


Primary Information

BoMiProt ID Bomi5239
Protein Name Docking protein 1/Downstream of tyrosine kinase 1
Organism Bos taurus
Uniprot IdQ5EA84
Milk FractionWhey
Ref Sequence Id  NP_001019714.2
Aminoacid Length 483
Molecular Weight 52206
Fasta Sequence https://www.uniprot.org/uniprot/Q5EA84.fasta
Gene Name DOK1
Gene Id 514962
Protein Existence Status reviewed

Secondary Information

Protein Function acts as a tumor suppressor in breast cancer by inhibitory effect on major oncogenic signaling pathways such as Mek/Erk/PI3k/Akt and Wnt/β-catenin
Biochemical Properties Full-length(FL) p62 DOK1 has an N-terminal plextrin homology (PH) domain formembrane binding, a phospho-tyrosine-binding (PTB) domain for in-teraction with phospho-tyrosine substrates (e.g.growth factor recep-tors, integrins,etc.)and a C-terminal domain withproline and phospho-tyrosine residues which bind SH3-domains andSRC kinase, respectively
PTMs Acetylation and phosphorylation on Tyr residue
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5EA84|DOK1_BOVIN Docking protein 1 OS=Bos taurus OX=9913 GN=DOK1 PE=2 SV=1 MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKGS*48SSGGGRGSSRRL DCKVIRLAECVSVAPVAVESPPEPGAASFRLDTAQRSHLLAADAPSSAAWVQTLCQNAFP KGSWALAPAENPPKLSALEMLENSLYSPSWEGSQFWVTVQKTEAAERCGLHGSYVLRVEA ERLTLLAPGAQRQILEPLLFWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGND IFQAVETAIHRQKIQGKAGQGQDVLRADS*269HEGEVADGKLASLAAPLELPGS*291PPALY*296SEPL DSLRIPPGPSQDSLYSDPLDSTPARAGEGTQLKKALY*337WDLCEHVQQKLIKAKLTDPKEDP IY*362DEPEGLAPATLRGLY*377DLPQEPKDAWWCQARVKEEGY*398ELPYNPAMDDY*409AVPPPRS*416TKPFPAPKPQGLALSESGAATGSGSQGHSSDTALY*451SQVQKSGASGS*462WDCGLSGVVTDRTGAKSE GST
Predicted Disorder Regions 51-58, 81-84, 267-270, 295-331, 401-418, 430-483
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs inhibit the regulation of the insulin signaling pathway
Additional Comments DOK1 also triggers apoptosis by recruiting and interacting withSMADs and inhibits expression of inflammato-ry genes driven by NFκBandSTATs in hematopoietic cells
Bibliography 1.Tuna E, Ersoy YE, Bulut P, Ozdemir F, Buyru N. Analysis of the DOK1 gene in breast cancer. Mol Biol Rep. 2020 Mar;47(3):1605-1612. doi: 10.1007/s11033-020-05247-3. Epub 2020 Jan 9. PMID: 31919752. 2.C.L. Oxley, N.J. Anthis et al. J. Biol. Chem., 283 (9) (2008), pp. 5420-5426 3.N. Yamakawa, K. Tsuchida et al. EMBO J., 21 (7) (2002), pp. 1684-1694. 4.C.A. Nold-Petry, C.Y. Lo et al. Nat. Immunol., 16 (4) (2015), pp. 354-365