Search by BoMiProt ID - Bomi5235


Primary Information

BoMiProt ID Bomi5235
Protein Name DnaJ homolog subfamily C member 17
Organism Bos taurus
Uniprot IdQ2KI83
Milk FractionWhey
Ref Sequence Id NP_001039741.1
Aminoacid Length 304
Molecular Weight 34572
Fasta Sequence https://www.uniprot.org/uniprot/Q2KI83.fasta
Gene Name DNAJC17
Gene Id 524795
Protein Existence Status reviewed

Secondary Information

Protein Function Localized to nuclear speckles.heat shock protein (HSP40) family member, recognized essential function in early development.Role in splicing-related processes.
Biochemical Properties contains a RRM motif
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KI83|DJC17_BOVIN DnaJ homolog subfamily C member 17 OS=Bos taurus OX=9913 GN=DNAJC17 PE=2 SV=1 MAVTKELLQMDLYALLGIEEKAEDKEVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQAL EVLTDAAARAAYDKVRKAKKQAAERTQKLDERRKKVKLDLEARERQAQALGS*112EEEEESGS ARTLEQEIERLREEGSRQLEEQQRLIREQIRQEQEQRLTGMAKNPENKETPKLKLKWKSK KEAESQGGYSRDVLLQLFQKYGEVLNLVLSSKKAGTAVVEFATVKAAELAVQNEVGLVDN PLKISWLEGRPQSAMGHNHPGLSRGSVVSERDYESLVMMRMRQAAERQQLIAQMQQEDQA GQPT
Predicted Disorder Regions 39-52, 77-185, 250-269, 286-304
DisProt Annotation
TM Helix Prediction no TM helices
Additional Comments DNAJC17 knockout mouse embryos die prior to implantation.In humans, germline homozygous mutations in DNAJC17 have been found in syndromic retinal dystrophy patients, while heterozygous mutations represent candidate pathogenic events for myeloproliferative disorders.
Bibliography 1.Pascarella A, Ferrandino G, Credendino SC, Moccia C, D'Angelo F, Miranda B, D'Ambrosio C, Bielli P, Spadaro O, Ceccarelli M, Scaloni A, Sette C, De Felice M, De Vita G, Amendola E. DNAJC17 is localized in nuclear speckles and interacts with splicing machinery components. Sci Rep. 2018 May 17;8(1):7794. doi: 10.1038/s41598-018-26093-1. PMID: 29773831; PMCID: PMC5958099.