Search by BoMiProt ID - Bomi5231


Primary Information

BoMiProt ID Bomi5231
Protein Name DnaJ homolog subfamily B member 4
Organism Bos taurus
Uniprot IdQ2KIT4
Milk FractionExosomes
Ref Sequence Id NP_001039968.1
Aminoacid Length 337
Molecular Weight 37851
Fasta Sequence https://www.uniprot.org/uniprot/Q2KIT4.fasta
Gene Name DNAJB4
Gene Id 541274
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells  gluteal muscle
Protein Function A chaperone which stimulates ATP hydrolysis and the folding of unfolded proteins mediated by HSPA1A/B.
PTMs Phosphoserine
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus OX=9913 GN=DNAJB4 PE=2 SV=1 MGKDYYCILGIEKGASDEDIKKAYRKQALRFHPDKNKSPQAEERFKEVAEAYEVLSDPKK REIYDQFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGR DS*122DEMEVDGDPFGAFGFSMNGYPRDRNS*148VGPSRLKQDPPVIHELRVSLEEIYSGCTKRMK ISRKRLNPDGRSYRTEDKILTIEIKKGWKEGTKITFPREGDETPTSIPADIVFVIKDKDH PKFKRDGSNIIYTAKISLREALCGCSINVPTMDGRTIPMTINDIVKPGMRRRIIGYGLPF PKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS
Predicted Disorder Regions 73-89, 135-153,
DisProt Annotation
TM Helix Prediction No TM helices