Search by BoMiProt ID - Bomi5229


Primary Information

BoMiProt ID Bomi5229
Protein Name DnaJ homolog subfamily B member 11/ER-associated DNAJ/Endoplasmic reticulum DNA J domain-containing protein 3
Organism Bos taurus
Uniprot IdQ3ZBA6
Milk FractionWhey
Ref Sequence Id NP_001029440.1
Aminoacid Length 358
Molecular Weight 40504
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZBA6.fasta
Gene Name DNAJB11
Gene Id 506316
Protein Existence Status Reviewed

Secondary Information

Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZBA6|DJB11_BOVIN DnaJ homolog subfamily B member 11 OS=Bos taurus OX=9913 GN=DNAJB11 PE=2 SV=1 MAPQNLGTFCLLLLYLIGTVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDD PRAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGT PRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQL GPGRFQMT*188QEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLR FRIKVVKHSIFERRGDDLYTN*261VTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLW KKGEGLPNFDNNNIKGSLIITFDVDFPKEQLSEEAREGIKQLLKQGSVQKVYNGLQGY
Predicted Disorder Regions 95-102, 163-169, 350-353
DisProt Annotation
TM Helix Prediction 1TMH; (5-23)