Search by BoMiProt ID - Bomi5228


Primary Information

BoMiProt ID Bomi5228
Protein Name DnaJ homolog subfamily B member 1
Organism Bos taurus
Uniprot IdQ3MI00
Milk Fractionwhey
Ref Sequence Id NP_001028935.1
Aminoacid Length 340
Molecular Weight 38217
Fasta Sequence https://www.uniprot.org/uniprot/Q3MI00.fasta
Gene Name DNAJB1
Gene Id 538426
Protein Existence Status reviewed

Secondary Information

Protein Function a member of the heat shock 40 protein family forms a complex with heat shock cognate protein 70 (HSC70) to sequester p53 in the cytosol.negative regulator of apoptosis.binds to and reduces stability via ubiquitin-dependent PDCD5 degradation.DNAJB1 binds to MDM2 in vitro and in vivo through its C-terminus and stabilizes MDM2 ,slows MDM2-mediated degradation thus allowing cancer cell proliferation
Biochemical Properties The C-terminus of DNAJB1 is essential for its interaction with MDM2 and for MDM2 accumulation
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3MI00|DNJB1_BOVIN DnaJ homolog subfamily B member 1 OS=Bos taurus OX=9913 GN=DNAJB1 PE=2 SV=3 MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK REIFDRYGEEGLKGSGPSGGSSGGTNGTSFSYTFHGDPHAMFAEFFGGRNPFDNFFGQRN GEEGMDIDDPFSGFPMGMGGFTNMNFGRSRPAQEPTRKKQDPPVTHDLRVSLEEIYSGCT KKMKISHKRLNPDGKSIRNEDKILTIEVKRGWKEGTKITFPKEGDQTSNNIPADIVFVLK DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGE GLPLPKT*307PEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
Predicted Disorder Regions 73-99, 146-160
DisProt Annotation
TM Helix Prediction No TM helices
Linking IDs