Search by BoMiProt ID - Bomi5213


Primary Information

BoMiProt ID Bomi5213
Protein Name DNA-binding protein RFX2/Regulatory factor X 2
Organism Bos taurus
Uniprot IdA6QLW9
Milk Fractionwhey
Ref Sequence Id NP_001095642.1
Aminoacid Length 707
Molecular Weight 77673
Fasta Sequence https://www.uniprot.org/uniprot/A6QLW9.fasta
Gene Name RFX2
Gene Id 534475
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells Pachytene spermatocytes and sperms
Protein Function RFX2 transcription factor is a master regulator of genes required for the haploid phase during spermatogenesis,role in DNA damage responses,morphogenesis, and virulence.Sperm Flagellum Assembly
Biochemical Properties highly conserved 76-residue winged-helix DNA binding domain. Recognizes and binds the X-box, a regulatory motif with DNA sequence 5'-GTNRCC(0-3N)RGYAAC-3' present on promoters.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QLW9|RFX2_BOVIN DNA-binding protein RFX2 OS=Bos taurus OX=9913 GN=RFX2 PE=2 SV=1 MQNSESGSDSPASVALCSSAAAQAPVAQPVTAS*33PQRVLVQAAGSAPKGAQMQPLSLPRVQ QVTQQVQPAQHVYPAQLQYVEGGDAVFTNGALRTAYAYNPEPQMYAPSSAASYFEAPGGA QVTVAGSSPPAVPSHSMVGITMDVGGSPIVSSAGAYLIHGGMDGTRHTLAHTSRSSPATL EMAIENLQKSEGITSHKSGLLNSHLQWLLDNYETAEGVSLPRSSLYNHYLRHCQEHKLDP VNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGIRLKPDSPLNRLQEDTQYMAMRQQPV HQKPRYRPAQKTDSLGESGSHSSLHSTPEQAMAAQSQHHQQYIDVSHVFPEFPAPDLGSV LLQESITLHDVKALQLAYRRHCEATLDVVMNLQFHYIEKLWLSFWNSKSSSDGPTSLPAS*420 DEEPEGAVLPKDKLVSLCKCDPVLRWMRTCDHILYQALVEILIPDVLRPVPSTLTQAIRN FAKSLEGWLTNAMSDFPQQVIQTKVGVVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQ MLSDLNRVDFANVQEQASWVCQCEEGVVQRLEQDFKLTLQQQSSLDQWASWLDNVVTQVL KQHAGSPSFPKAARQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLVEHR VAEATGETPIAVMGEFNDLASLSLTLLDKGGCVWALPPVHSGGGGSP
Predicted Disorder Regions 1-62, 108-129, 172-177, 309-326, 415-424, 702-707
DisProt Annotation
TM Helix Prediction no TM helices
Additional Comments A targeted mutation of Rfx2 was created in mice. Rfx2-/- mice are perfectly viable but show complete male sterility.
Bibliography 1.Hao B, Clancy CJ, Cheng S, Raman SB, Iczkowski KA, Nguyen MH. Candida albicans RFX2 encodes a DNA binding protein involved in DNA damage responses, morphogenesis, and virulence. Eukaryot Cell. 2009 Apr;8(4):627-39. doi: 10.1128/EC.00246-08. Epub 2009 Feb 27. PMID: 19252121; PMCID: PMC2669197. 2.Wu Y, Hu X, Li Z, Wang M, Li S, Wang X, Lin X, Liao S, Zhang Z, Feng X, Wang S, Cui X, Wang Y, Gao F, Hess RA, Han C. Transcription Factor RFX2 Is a Key Regulator of Mouse Spermiogenesis. Sci Rep. 2016 Feb 8;6:20435. doi: 10.1038/srep20435. PMID: 26853561; PMCID: PMC4745085.