Search by BoMiProt ID - Bomi5192


Primary Information

BoMiProt ID Bomi5192
Protein Name DNA polymerase alpha subunit B/DNA polymerase alpha 70 kDa subunit
Organism Bos taurus
Uniprot IdQ58D13
Milk FractionWhey
Ref Sequence Id NP_001019713.2
Aminoacid Length 604
Molecular Weight 66955
Fasta Sequence https://www.uniprot.org/uniprot/Q58D13.fasta
Gene Name POLA2
Gene Id 514793
Protein Existence Status reviewed

Secondary Information

Protein Function subunit of DNA polymerase alpha complex associates with primase and forms a Polalpha-primase complex,which plays an imp function in replication initiation.Responsible for both initiation of both leading and lagging strands at the replication origins.The p49 is the primase catalytic subunit that synthesizes the RNA primer.
PTMs Phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q58D13|DPOA2_BOVIN DNA polymerase alpha subunit B OS=Bos taurus OX=9913 GN=POLA2 PE=2 SV=1 MAVSAQLLVEELQIFGLECEEAVIEKLVELCILYGQNEEGMASELIAFCTSTRKDCFTLE TLNSFEHEFLSKRVSKTRHGASKDKGLRHAGARDIVSIQELIEVEEEEETLLNSYTTPSK GSQKRTITT*129PET*132PLTKRSVSARS*143PHQLLS*149PSSFS*154PS*156ATPPQKYSSRSNRGEVVTSFGSAQGVSWSGRGGASPLSLKVLGHPEPLTGSYKYMFQKLPDIREVLTCKIEELGSELKEHYKIE AFAPILVPAQEPVTLLGQIGCDSNGKLNHKSVILEGDLEHSSGAQIPVDLSELKEYSLFP GQVVVMEGINTTGRKLVATRLYEGVPLPFHQPDEEDGDSEQFMVLVACGPYTTSDSITFD PLLDLITIINRDRPDVCILFGPFLDAKHEQVESCLLTSSFEDVFKQCLRTIIEGTRSSGS HLIIVPSLRDVHHEPVYPQPPFSCSDLLREDKKRVRLVSEPCTLSINGVIFGLTSTDLLF HMGAEEISSSSGTSDRFSRILRHILTQRSYYPLYPPQEDMAIDYENFYLYAQLPVTPDVF IAPSELRYFVKVGLNSAISLQCQNQFLSGALALNSSRVCWWGQWPRSFGGGVGVENKSVS IMLK
Predicted Disorder Regions 75-169
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylated in a cell cycle-dependent manner, in G2/M phase.The p70(catalytic) subunit is phosphorylated only in G2/M phase.p180 is 5 times more highly phosphorylated.
Bibliography 1.Nasheuer HP, Moore A, Wahl AF, Wang TS. Cell cycle-dependent phosphorylation of human DNA polymerase alpha. J Biol Chem. 1991 Apr 25;266(12):7893-903. PMID: 1902230. 2.Uchiyama M, Wang TS. The B-subunit of DNA polymerase alpha-primase associates with the origin recognition complex for initiation of DNA replication. Mol Cell Biol. 2004 Sep;24(17):7419-34. doi: 10.1128/MCB.24.17.7419-7434.2004. PMID: 15314153; PMCID: PMC506996.