Search by BoMiProt ID - Bomi5179


Primary Information

BoMiProt ID Bomi5179
Protein Name DNA excision repair protein ERCC-6-like/ATP-dependent helicase ERCC6-like
Organism Bos taurus
Uniprot IdA6QQR4
Milk FractionWhey
Ref Sequence Id NP_001096000.1
Aminoacid Length 1242
Molecular Weight 140510
Fasta Sequence https://www.uniprot.org/uniprot/A6QQR4.fasta
Gene Name ERCC6L
Gene Id 782916
Protein Existence Status reviewed

Secondary Information

Protein Function cooperates with topoisomerase II in mitosis to promote sister chromatid disjunction.function as a DNA-dependent ATPase that interacts with PLK to form a complex that maintains the chromosome architecture during prometaphase.
Biochemical Properties ATP binding activity.DNA helicase activity.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus OX=9913 GN=ERCC6L PE=2 SV=1 MEVSRGFAEAGALS*14PEQAASYLRYVKEAKEATKNGDLEQALKLFNLAKDIFPNEKVMSRI QKIQEALEELAEHGDDEFIDVCNSGLLLYQELHNQLYEYQKEGIAFLYSLYRDGRRGGIL ADDMGLGKTVQIIAFLSGMFDASLVNHVLLIMPTSLISTWLREFVKWTPGMRVKTFHGPS KDERTRNLCRIQQRNGVIITTYQMLINNWQQLSSLNGQEFLWDYVILDEAHKIKSSSTKS AICARAIPASNRILLTGTPIQNNLQELWSLFDFACQGSLLGTLRTFKMEYENPITRAREK DATPGEKALGFKISENLMAIIKPYFLRRTKEEVQKKKSSNPEVQLSEKSPDVGAICEMPS LSRKNDLIIWIRLVPLQEEIYRKFVSLDHIKELLMETRSPLAELGVLKKLCDHPRLLSAR ACGLLNLGAAKFSVQDEIEGEDSSDVDHIDQISDDTLMEESGKMLFLMDLLKKLRDEGHQ TLVFSQSRRILNIIERLLKNRHFKILRIDGTITHLVEREKRISLFQQNKDYSVFLLTTQV GGVGLTLTAASRVVIFDPSWNPATDAQAVDRVYRIGQKENVVVYRLITCGTVEEKIYRRQ VFKDSLIRQTTGDKKNPFRYFSKQELRELFTIEDFQNSATQLQLQSLHAAQRRSDKNLDE HIAFLHSLRIAGISDHDLMYTRDLSVKEELDVIEDSHYIQQRVQKAQFLVESESQNTELL MERQKMGNEGIWLREPVYQTKKKRPKVNKPQPQPS*755SHLPVYHTQEEISSLMAS*773IIIDDLP KEDEKDLSRIKLNDTIPQDGRHPCVITLNDDFVTT*815LPKGCGDVEEIFPDSLSGMALQKEA SQEGFMQESEQESPLASFNYLPSKSARVDLGPNLDQLEDDEVLHHCNPSPANPKTKEYQR PESNVSVIKIADDDLTAAHSALQDAQANEAKLEEEPLASSGQYACDFNLFLEDSADNGQN LSS*963QFLEHVEKENSLCGSAANSRAESVHS*989KACLSVDLS*998EEDDEPEEVVNVKIRRKARRID S*1021DNEDEHTFKDTSSTNPFNTSPFPFLSVKQFDAST*1055PKNDIS*1061LPERFFSPKISDSINKSVN SRRSLASRRS*1090LINVVLDHVEDMEERLDNSS*1110EAKVVEDHLEEGAEESGDEAPEHTKEDPSR ETLSSENKSSQLSTSKPGALAQETSPGDPEPLS**1180PQDEAMEAVNDYDTLVLHGK ELKECGKIQEALDCLVKALDIKSSDPEVMLMTLSLYKQLNKT
Predicted Disorder Regions 836-1059, 1102-1192
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation by PLK1 prevents the association with chromosome arms and restricts its localization to the kinetochore-centromere region.
Bibliography Xie Y, Yu J, Wang F, Li M, Qiu X, Liu Y, Qi J. ERCC6L promotes cell growth and invasion in human colorectal cancer. Oncol Lett. 2019 Jul;18(1):237-246. doi: 10.3892/ol.2019.10297. Epub 2019 Apr 30. PMID: 31289493; PMCID: PMC6540252.