Search by BoMiProt ID - Bomi5178


Primary Information

BoMiProt ID Bomi5178
Protein Name DNA excision repair protein ERCC-6-like 2
Organism Bos taurus
Uniprot IdA3KMX0
Milk FractionWhey
Aminoacid Length 1558
Molecular Weight 176299
Fasta Sequence https://www.uniprot.org/uniprot/A3KMX0.fasta
Gene Name ERCC6L2
Protein Existence Status reviewed

Secondary Information

Protein Function promotes double-strand break end-joining during DNA repair
Biochemical Properties rapidly engages in DNA repair through its C-terminal domains.
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus OX=9913 GN=ERCC6L2 PE=2 SV=3 MQPGCQALPPGQMDQSTPKPHAETNSKDIWHPGERCLAPSPDNEKLCEASIKSITVDENG KSFAVILYSNFQERRVPLKRLQEVKSVKDCSRNFIFDDEDLEKPYFPDRKFPSSAVPFQL SENGDSIPYTINRYLRDYQREGAQFLYGHFIQGRGCILGDDMGLGKTVQVISFLAAVLGK KGTREDIENNMPEFLLRNMKKDPPSTAKKMFLIVAPLSVLYNWKDELDTWGYFRVTILHG NKKDSELIRVKQRKCEIALTTYETLRLCLDELNSLEWSAVIVDEAHRIKNPKARVTEIMK ALRCNVRIGLTGTILQNNMKELWCVMDWAVPGLLGSRIHFKKQFSDPVEHGQRHTATKRE LATGRKAMQRLARKMSGWFLRRTKTLIKDQLPKKEDRMVYCSLTDFQKAVYQTVLETEDV SLILQSSEPCTCNSGQKRRNCCYKTNSQGETVKTLYFSYLAVLQKVANHVALLQTASTSR QQETLIKRICDQVFSRFPDFVQKSKDAAFETLSDPKYSGKMKVLQQLLNHCRKNKDKVLL FSFSTKLLDVLQQYCMASGLDYRRLDGSTKSEERIKIVKEFNSTQDVNICLVSTMAGGLG LNFVGANVVVLFDPTWNPANDLQAIDRAYRIGQCRDVKVLRLISLGTVEEIMYLRQVYKQ QLHCVVVGSENAKRYFEAVQGSKEHQGELFGVYNLFKLRSQGSCLTRDILEREGKVEAGI MTATTWLKEEPPVHKLETAREPDCREHRGPEQLAEAACDLCSDFSEDETASNSVTKTVKN KASDSSRASVSPGQFSLLQCGFSKLFETKCETVEDGDENIASDNESSDEQPTCFSTEAKN AGCQKSQDSLGTLKHQKLANVLNPNGKCVFEKSEKILKENIPSESDDEKNFKNTVDHHHI LQNVTESEDSDIIFPTQYTTQRFLKKNIRFKPPVDGSEDSESENPVNIKNNGDDTKTNVR GNGLISKQLNLEIETLKSNTKRKGGSDIS*989DES*992DDIEVFCKSRVRKQRATSSLRFKRKKEN KRELYTFPKTMKKANQQCATDEDCNSQTIDDFSSSDDNLSVGHISFSKQNHRPKTIKDKI SVSSKLTNHKRNSTFIPRKPMKFSNESVVNQNRICESMDKFLDGVQEVAYIHSNQNVIGS SKAENHMSRWAARDVFELKQFSQLPANIAVCTSKTHKEKMKGDISTRTKECQPLSEGSIS FPLYISHPVSQKKKKVCRIDQTTFIIGETPKGIRRKQFEEMASYFKLSSVKEFAKRVTNA TSEERQKMLRDFYTSQYPEVREFFVDSPSECTKSASEKGERVENKSEKRQSLMKEQPSDS ETLSFKNSTKKISPIFSPSICKKKSIKFQNHSSCKKKVLSNDVETKKLPISCTQETDGGE RS*1382QAS*1385EGTAASCSLNSKSGADELGKLENAGKGQQDLTSLGISRNGPIFQVENKTIENPVL EDTSVVGLLGDTSILDDLFKSHENSPTQLPKKVLSGSIEKAKQRPKDFWDILNDQNDDSL SKLTDLAVIETLCEKVPFAASSKRKEDLEASLWKSNEKFLWKKFNSSDTDESTANTQE
Predicted Disorder Regions 15-26, 1384-1418
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Liu X, Liu T, Shang Y, Dai P, Zhang W, Lee BJ, Huang M, Yang D, Wu Q, Liu LD, Zheng X, Zhou BO, Dong J, Yeap LS, Hu J, Xiao T, Zha S, Casellas R, Liu XS, Meng FL. ERCC6L2 promotes DNA orientation-specific recombination in mammalian cells. Cell Res. 2020 Sep;30(9):732-744. doi: 10.1038/s41422-020-0328-3. Epub 2020 Apr 30. PMID: 32355287; PMCID: PMC7608219.