Search by BoMiProt ID - Bomi5175


Primary Information

BoMiProt ID Bomi5175
Protein Name DNA damage-binding protein 2/Damage-specific DNA-binding protein 2
Organism Bos taurus
Uniprot IdQ0VBY8
Milk FractionWhey
Ref Sequence Id NP_001069256.1
Aminoacid Length 426
Molecular Weight 47591
Fasta Sequence https://www.uniprot.org/uniprot/Q0VBY8.fasta
Gene Name DDB2
Gene Id 519357
Protein Existence Status reviewed

Secondary Information

Protein Function  DDB2 acts as a critical regulator of ROS1-mediated active DNA demethylation.DNA damage binding protein 2 (DDB2), a DNA damage-recognition factor, could protect triple-negative breast cancer cells from Poly ADP-ribose polymerase inhibitors (PARPi) by regulating DNA double-strand break repair through the homologous recombination pathway.
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VBY8|DDB2_BOVIN DNA damage-binding protein 2 OS=Bos taurus OX=9913 GN=DDB2 PE=2 SV=1 MAPRKRPENQKTPEVVVRPKSKRNRS*26PRELEPEAKKLCVKGPGSSRRFDSGLWAGLASLR VPPLCSSIVRALHQHKLGTAAWPSLQQGLQQSFLNSLASYRIFQKAAPFDRRATSLAWHP THPSTLAVGSKGGDILLWNFGIKDKPTFIKGIGAGGSITGMKFNPLNTNQFFTSSMEGTT RLQDFKGNTLRVFASSDTCNVWFCSLDVSVKSRVVVTGDNVGHVILLNMDGRELWNLRMH KKKVTHVALNPCCDWLLATASVDQTVKIWDLRQVRGKSSFLHSLPHRHPVNAAHFSPDGA QLLTTDQKSEIRVYSACQWDCPPSLIPHPHRHFQHLTPIKASWHPRYNLIVVGRYPDPNF KSCSPHELRTIDVFDGSSGKIMYQLYDPESSGIMSLNEFNPMGDTLASVMGYHILVWSPE DAGTQK
Predicted Disorder Regions (1-44)
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments , DDB2 was reported to regulate the homologous recombination pathway in non‐small cell lung cancer by facilitating the phosphorylation of checkpoint kinase 1
Bibliography 1.Córdoba-Cañero D, Cognat V, Ariza RR, Roldán Arjona T, Molinier J. Dual control of ROS1-mediated active DNA demethylation by DNA damage-binding protein 2 (DDB2). Plant J. 2017 Dec;92(6):1170-1181. doi: 10.1111/tpj.13753. Epub 2017 Nov 27. PMID: 29078035. 2.Zhao L, Si CS, Yu Y, Lu JW, Zhuang Y. Depletion of DNA damage binding protein 2 sensitizes triple-negative breast cancer cells to poly ADP-ribose polymerase inhibition by destabilizing Rad51. Cancer Sci. 2019 Nov;110(11):3543-3552. doi: 10.1111/cas.14201. Epub 2019 Oct 6. PMID: 31541611; PMCID: PMC6825009.