Search by BoMiProt ID - Bomi5173


Primary Information

BoMiProt ID Bomi5173
Protein Name DNA annealing helicase and endonuclease ZRANB3/Annealing helicase 2/Zinc finger Ran-binding domain-containing protein 3
Organism Bos taurus
Uniprot IdE1BB03
Milk FractionWhey
Aminoacid Length 1074
Molecular Weight 121768
Fasta Sequence https://www.uniprot.org/uniprot/E1BB03.fasta
Gene Name ZRANB3
Protein Existence Status reviewed

Secondary Information

Protein Function A Replication stress response protein and it stabilizes and resolves stalled replication forks by mechanisms that include fork remodeling to facilitate repair or bypass of damaged templates.
Biochemical Properties ZRANB3 contains a domain similar in sequence to the HARP domains of SMARCAL1.
Significance in milk Involved in animal’s growth processes and in response to heat stress.
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|E1BB03|ZRAB3_BOVIN DNA annealing helicase and endonuclease ZRANB3 OS=Bos taurus OX=9913 GN=ZRANB3 PE=3 SV=3 MSRGHNIKKSLTPQISCSTSESYKQLDFLPDKLRAKLLPFQKDGITFALRRDGRCMVADE MGLGKTVQAIGIAYFYKEEWPLLIVVPSSLRYPWTEEIEKWIPELSPEEINVIQNKTDVG RISTSKVTVLGYGLLTTDAETLIDALNNQNFKVVIVDESHYMKSRSATRSRILLPIVQKA KRAILLTGTPALGRPEELFMQIEALFPQKFGTWTEYAKRYCNAHVRYFGRRSQWDCRGAS NLNELHQLLSDIMIRRLKTEVLTQLPPKIRQRIPFDLPSAAAKELNSSFEEWEKLMRDPY SGATETVMGLITRMFKQTAIAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIE NKTRYIRIDGSVPSSERIHLVNQFQKDPETRVAILSIQAAGQGLTFTAATHVVFAELYWD PGHIKQAEDRAHRIGQCSSVNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKLQAE EGDKEKWDFLQFAEAWTPNERSEELRDEMLFTHFEKEKQRDIRSFFLPNAKKRQLETSCD ESRVSQEKNTIVPADPVKTATRGDES*566DLEPEAKKLKSVAIDDPCRPPEEQPCRPGQAEAL LTFGICKAKAQATTPAFCGEGWQCAFCTYINNSVLPYCEMCENPRGGAVPQIDSLNQTQN KNKNEKDDSQDTSKKIQTSSDGEKQVLAHSTPEPLAKSKEEISTTESEDRLTPQPGDEQL KNWPVYDTLMFCASKNTDRIHVYTKDGNQMNCNFIPLDIKLDLWEDLPASFQLKQNRSLI LRFVREWSSLTAMKQKIIKKSGQLFRSPVLALEEIAKQQTKQNSTKRYITKEDVAAASMD KVKNDGGHVRLITKGPKPGDPSTKEFLEGGECVPFLNPCTAQGDLILKASTSKGYLQAVD NEGNPLCLRCQQPTCQTKQERKADAWDSRFCSLKCQEEFWIRSNNSYLRAKVFEIEHGVC QLCNLNAQELFLRLRDAPKSQRKSLLDATWTSKLPLEQLNEMIRSPGEGHFWQVDHIKPV SGGGGQCSLDNLQTLCTVCHRERTAQQAKERSQVRRQSLASNHGSDITRFLVKK
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments ZRANB3 is recruited by binding to polyubiquitinated PCNA.
Bibliography 1.Badu-Nkansah A, Mason AC, Eichman BF, Cortez D. Identification of a Substrate Recognition Domain in the Replication Stress Response Protein Zinc Finger Ran-binding Domain-containing Protein 3 (ZRANB3). J Biol Chem. 2016 Apr 8;291(15):8251-7. doi: 10.1074/jbc.M115.709733. Epub 2016 Feb 16. PMID: 26884333; PMCID: PMC5414104. 2.Yuan J, Ghosal G, Chen J. The HARP-like domain-containing protein AH2/ZRANB3 binds to PCNA and participates in cellular response to replication stress. Mol Cell. 2012 Aug 10;47(3):410-21. doi: 10.1016/j.molcel.2012.05.025. Epub 2012 Jun 14. PMID: 22705370; PMCID: PMC3601832.