Search by BoMiProt ID - Bomi5157


Primary Information

BoMiProt ID Bomi5157
Protein Name Distal membrane-arm assembly complex protein 2/ATP synthase subunit s-like protein
Organism Bos taurus
Uniprot IdA6QNS9
Milk FractionWhey
Ref Sequence Id NP_001258937.1
Aminoacid Length 301
Molecular Weight 33185
Fasta Sequence https://www.uniprot.org/uniprot/A6QNS9.fasta
Gene Name DMAC2/ATP5SL
Gene Id 530597
Protein Existence Status reviewed

Secondary Information

Protein Function Involved in mitochondrial respiratory chain complex I assembly. Colocalizes with mitochondrial respiratory chain complex
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QNS9|DMAC2_BOVIN Distal membrane-arm assembly complex protein 2 OS=Bos taurus OX=9913 GN=DMAC2 PE=2 SV=2 MAAPRASLRLVAPVWNRGTSGIRGLSKAVDPEGSQKKGRTLLQFLTDHFYDVEAVREYLL RKQVLKVQKKNRSFTYIKERYGPYVAGAYFVLKQGGAVKFRDREWMRANEQGLSSLEFRK LQEVPVEAVDASGCAINYQGLDNLLALKELQSLSLRRCPHVDDWCLGRLYQLADSLQELS LAGCPRISERGLACLHHLQNLRRLDISDLPAVSNPGLTQILVEEMLPHCEVLGADWAQGL KVGPEEQSRDAASS*254PIPAWPSAPPHQARSLPGCAERPTAHPSGSVGLTQLGGSGWGEGRR A
Predicted Disorder Regions 1-6, 24-35, 249-282, 292-301
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Stroud DA, Surgenor EE, Formosa LE, Reljic B, Frazier AE, Dibley MG, Osellame LD, Stait T, Beilharz TH, Thorburn DR, Salim A, Ryan MT. Accessory subunits are integral for assembly and function of human mitochondrial complex I. Nature. 2016 Oct 6;538(7623):123-126. doi: 10.1038/nature19754. Epub 2016 Sep 14. PMID: 27626371.