Search by BoMiProt ID - Bomi5129


Primary Information

BoMiProt ID Bomi5129
Protein Name Diphthine--ammonia ligase/ATP-binding domain-containing protein 4/Diphthamide synthase/Protein DPH6 homolog
Organism Bos taurus
Uniprot IdQ2HJF5
Milk FractionExosomes
Ref Sequence Id NP_001070484.1
Aminoacid Length 267
Molecular Weight 29860
Fasta Sequence https://www.uniprot.org/uniprot/Q2HJF5.fasta
Gene Name DPH6
Gene Id 767944
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells  milk 
Protein Function Amidase that catalyzes the last step of diphthamide biosynthesis using ammonium and ATP. 
PTMs Phosphorylation at Tyr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2HJF5|DPH6_BOVIN Diphthine--ammonia ligase OS=Bos taurus OX=9913 GN=DPH6 PE=2 SV=1 MRVAALISGGKDSCYNMMQCVAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDL YAEAMALPLYRRTIRGKSVDTGPVYTKCEGDEVEDLY*97ELLKLVKEKEEVEGISVGAILSD YQRVRVENVCKRLNLQPLAYLWQRNQEDLLQEMISSNIQAIIIKVAALGLDPDKHLGKPL DQMEPYLLELSKKYGVHVCGEGGEYETFTLDCPLFKKKIIVDSSEVVTHSADAFAPVAYL RFLELHLEDKVSPVPDNCRTSNDIHNS
Predicted Disorder Regions 251-267
DisProt Annotation
TM Helix Prediction No TM helices