Search by BoMiProt ID - Bomi5121


Primary Information

BoMiProt ID Bomi5121
Protein Name Dimethylaniline monooxygenase [N-oxide-forming] 3/Dimethylaniline oxidase 3/Hepatic flavin-containing monooxygenase 3/Trimethylamine monooxygenase
Organism Bos taurus
Uniprot IdQ8HYJ9
Milk FractionWhey
Ref Sequence Id NP_776482.1
Aminoacid Length 532
Molecular Weight 60093
Fasta Sequence https://www.uniprot.org/uniprot/Q8HYJ9.fasta
Gene Name FMO3
Gene Id 281167
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells found in liver
Protein Function Essential hepatic enzyme that catalyzes the oxygenation of a wide variety of nitrogen- and sulfur-containing compounds including drugs as well as dietary compounds. catalyzes metabolism of trimethylamine (TMA), via the production of trimethylamine N-oxide (TMAO) metabolite.FMO3 directly impacts both platelet responsiveness and rate of thrombus formation.Defects in FMO3 are the cause of a fishy off-flavor in cow milk due to by an elevated level of trimethylamine (TMA) in body fluids.
Significance in milk Low abundance protein in bovine milk.Absence of FMO3 leads to fishy flavour in milk due to increased build-up of TMA, and thus might play an important role in maintaining the quality of milk.The presence of FMO3 at high concentrations in Kashmiri cattle milk can favour utilization of Kashmiri cattle milk in commercial preparations for the promotion of human health and nutritional status.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q8HYJ9|FMO3_BOVIN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Bos taurus OX=9913 GN=FMO3 PE=2 SV=1 MVKKVAIIGAGISGLASIRNCLEEGLEPTCFEKGEDIGGLWKFSDHVEEGRASIYRSVFT NSSKEMTCFPDFPFPDDFPNFMHNSKLQEYITMFAKEKNLLKYIQFKTIVSSVNKRPDFQ TTGQWDVITEKDGKKESAVFDAVMICSGHHVYPNIPKESFPGIKLFKGKCFHSRDYKEPG IFKGKRVLVIGLGNSGCDIASELSHIAEKVIISSRSGSWVMSRVWDEGYPWDMLFITRFE TFLKNTLPTVISNWWYMKQMNARFKHENYGLMPLNSTLRKEPVFNDELPACILCGIVTIK PNVKEFTEDSAIFEDGTVFKAIDYVIFATGYSYAYPFLDDSIIKSRDNEVTLFKGIFPPP LEKPTLAVIGLVQSLGAAIPTTDLQSRWAVQVIKGTCPLPS*401VKDMMNDIDEKMGKKLKLF GKSDTIQTDYVVYMDELASFIGAKPNIPWLFLTDPKLALEVYFGPCTPYQFRLVGPGKWP GARNAILTQWDRLLKPMTTRVVGSPLKPCLFCNWFRPVLISVVSIAALIVLF
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments a hepatic microsomal enzyme that oxidizes a host of drugs, xenobiotics and other chemicals.
Bibliography Lundén A, Marklund S, Gustafsson V, Andersson L. A nonsense mutation in the FMO3 gene underlies fishy off-flavor in cow's milk. Genome Res. 2002 Dec;12(12):1885-8. doi: 10.1101/gr.240202. PMID: 12466292; PMCID: PMC187563.