Search by BoMiProt ID - Bomi5116


Primary Information

BoMiProt ID Bomi5116
Protein Name Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial/2-oxoglutarate dehydrogenase complex component E2/Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Organism Bos taurus
Uniprot IdP11179
Milk FractionWhey
Ref Sequence Id NP_001068750.1
Aminoacid Length 455
Molecular Weight 48973
Fasta Sequence https://www.uniprot.org/uniprot/P11179.fasta
Gene Name DLST
Gene Id 506888
Protein Existence Status reviewed

Secondary Information

Protein Function Dihydrolipoamide succinyltransferase (E2) component of the 2-oxoglutarate dehydrogenase complex.
PTMs Acetylation, Phosphorylation,Lipoylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P11179|ODO2_BOVIN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Bos taurus OX=9913 GN=DLST PE=1 SV=2 MLSRSRCASRAFSRSLSAFQKGNCPLVRRSLPGISLCQGPGYPDSRKTVINSSNIFSVRF FRTTAVCKDDVITVKTPAFAES*82VTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPA NGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAAAPAAAAPKAEPTVSAVPPPPAA PIPTQMPPVPSPSQPLTSKPVSAVKPTAAPPRAEAGAGVGLRSEHREKMNRMRQRIAQRL KEAQNTCAMLTTFNEIDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVV NAVIDDATKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTISELGEKARKNE LAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIVDRPVVIGGKVEVRPMMYV ALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
Predicted Disorder Regions (148-223)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Important for catalytic activity of DLST.Increased lipoylation can enhance brown adipose tissue function, decreasing age-associated obesity
Bibliography 1.Bailey, P.S.J., Ortmann, B.M., Martinelli, A.W. et al. ABHD11 maintains 2-oxoglutarate metabolism by preserving functional lipoylation of the 2-oxoglutarate dehydrogenase complex. Nat Commun 11, 4046 (2020). https://doi.org/10.1038/s41467-020-17862-6 2.Harhay, G. P., Sonstegard, T. S., Keele, J. W., Heaton, M. P., Clawson, M. L., Snelling, W. M., Wiedmann, R. T., Van Tassell, C. P., & Smith, T. P. (2005). Characterization of 954 bovine full-CDS cDNA sequences. BMC genomics, 6, 166. https://doi.org/10.1186/1471-2164-6-166