Search by BoMiProt ID - Bomi5099


Primary Information

BoMiProt ID Bomi5099
Protein Name Developmentally-regulated GTP-binding protein 1/Neural precursor cell expressed developmentally down-regulated protein 3/TRAFAC GTPase DRG1 NEDD-3/Translation factor GTPase DRG1
Organism Bos taurus
Uniprot IdQ3MHP5
Milk FractionWhey
Ref Sequence Id NP_001029863.1
Aminoacid Length 367
Molecular Weight 40542
Fasta Sequence https://www.uniprot.org/uniprot/Q3MHP5.fasta
Gene Name DRG1
Gene Id 540161
Protein Existence Status reviewed

Secondary Information

Protein Function Developmentally regulated GTP-binding protein 1 (DRG1) is a microtubule polymerase that also bundles and stabilizes microtubules.Drg1-Dvl interaction regulates apical actin polymerization and stability in MCCs. Thus, Drg1 is a newly identified partner of Dvl in regulating ciliogenesis.
Biochemical Properties Developmentally regulated GTP-binding proteins (DRGs) are a deeply conserved group of proteins belonging to the subfamily of Obg GTPases.DRGs are conserved from archaebacterial having one DRG to eukaryotes from yeast to human, containing DRG1 and DRG2
PTMs Acetylation, Hydroxylation at C-3 of Lys-22, Phosphorylated at Thr-100 by STK16, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3MHP5|DRG1_BOVIN Developmentally-regulated GTP-binding protein 1 OS=Bos taurus OX=9913 GN=DRG1 PE=2 SV=1 MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVA KTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT*100TVPGVIRYKGAKIQLLDLPG IIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIG FKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVY IPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKG QLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDED VIQIVKK
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments DRG1 is highly upregulated in mouse embryonic brain it was suggested to act as a developmental factor9 . However, DRGs are also expressed widely in adult tissue.
Bibliography 1.Lee M, Hwang YS, Yoon J, Sun J, Harned A, Nagashima K, Daar IO. Developmentally regulated GTP-binding protein 1 modulates ciliogenesis via an interaction with Dishevelled. J Cell Biol. 2019 Aug 5;218(8):2659-2676. doi: 10.1083/jcb.201811147. Epub 2019 Jul 3. PMID: 31270137; PMCID: PMC6683737. 2.Schellhaus AK, Moreno-Andrés D, Chugh M, Yokoyama H, Moschopoulou A, De S, Bono F, Hipp K, Schäffer E, Antonin W. Developmentally Regulated GTP binding protein 1 (DRG1) controls microtubule dynamics. Sci Rep. 2017 Aug 30;7(1):9996. doi: 10.1038/s41598-017-10088-5. PMID: 28855639; PMCID: PMC5577222.