Search by BoMiProt ID - Bomi5095


Primary Information

BoMiProt ID Bomi5095
Protein Name Desmoglein-1/Desmosomal glycoprotein 1/Pemphigus foliaceus antigen
Organism Bos taurus
Uniprot IdQ03763
Milk FractionWhey
Ref Sequence Id NP_776470.1
Aminoacid Length 1043
Molecular Weight 112243
Fasta Sequence https://www.uniprot.org/uniprot/Q03763.fasta
Gene Name DSG1
Gene Id 281131
Protein Existence Status reviewed

Secondary Information

PTMs Cleavage on pair of basic residues, Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q03763|DSG1_BOVIN Desmoglein-1 OS=Bos taurus OX=9913 GN=DSG1 PE=1 SV=1 MNWPFFRAAVVLFIFLVVLEVNSDFRIQVRDYNTKNGTIKWHSLRRQKREWIKFAAACRE GEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEIN*110ITSIVDREVT PFFIIYCRALNSLGQDLEKPLELRVRVLDINDNPPVFSMSTFVGEIEENSNANTLVMVLN*180 ATDADEPNNLNSKIAFKIIRQEPSDSPMFIINRYTGEIRTMNNFLDREQYGQYSLAVRGS DRDGGADGMSAECECNIKILDVNDNIPYMELPTQSISIEENSLNSNLLQIRVIDLDEEFS ANWMAVIFFISGNEGNWFEIEMNERTNVGTLKVVKPLDFEAMNNLQLSLGVRNKAEFHQS IMSQYKLTATAISVTVLNVVEGSVFRPGSKTFVVNSNMGQNYKIGEYVAWDLDANRPSTT VRYVMGRNPTDLLAIDSKTAIITLRNKVTMEQYKILGGKYQGTILSIDDALQRTCTGTIV INLENGGWKTERPNVN*496GSTTSAYGLTSGGVTTNGYTTGGGVGTVTFAVGTNGYGVGTGVY QPLRDNVHFGPAGIGLLIMGFLVLGLVPFLLMCCDCGGAPGGGAAFEPVPECSDGAIHSW AVEGAQADPGVLANSAVPCIPVTNANVIEYVDNSGVYTNEYGAREMQDLGGGERTTGFEL TDGVKMSGGPEICQEYPGTLRRNSMRECREGGLNMNFMESYFCQKAYAYADEDEGRPSND CLLIYDIEGAGSPAGSVGCCSFIGEDLDDSFLDTLGPKFKKLADISLGKDVEPFPDSDPS WPPKSTEPVCPPQGTEPTGGGHPPISPRFGTTTVISENTYPSGPGVQHPTPIPDPLGYGN VTVTESYTSSGTLKPSVHIHDNRHASNVVVTERVVGPISGADLQGMLEMPDLRDGSNVIV TERVIAPSSSLPTTLTIPDPRQSSNVVVTERVIQPTSGIVGNLSMHPELSNTHNVIVTER VVSGSGITGSSSLLGSAGGGSGGGIGLGSLGGGGGLSSSLGGAATIGHLRGSAEHHFSNT LGSASPTTTRSRITKYSTVQYTK
Predicted Disorder Regions 4 predicted disordered segments; 649th residue,(762-851), (908-918), (965-1029)
DisProt Annotation
TM Helix Prediction 2 TMHs: (514-536 ) and (549-571)