Search by BoMiProt ID - Bomi5089


Primary Information

BoMiProt ID Bomi5089
Protein Name Desmocollin-2 /Epithelial type 2 desmocollin
Organism Bos taurus
Uniprot IdP33545
Milk FractionWhey
Aminoacid Length 863
Molecular Weight 95875
Fasta Sequence https://www.uniprot.org/uniprot/P33545.fasta
Gene Name DSC2
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells heart and skin tissue
Protein Function Component of intercellular desmosome junctions.Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion.
Biochemical Properties Calcium may be bound by the cadherin-like repeats.Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.Ser729, Ser733 and Ser738 are conserved between species:human, mouse and bovine.
Significance in milk desmocollin isoform expression has important functional consequences in epithelial proliferation, stratification, and differentiation.Nutrient delivery.
PTMs Cleavage on pair of basic residues, Glycosylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P33545|DSC2_BOVIN Desmocollin-2 (Fragment) OS=Bos taurus OX=9913 GN=DSC2 PE=2 SV=1 KFIGRVNLKECFKSATLIHSSDPDFQILEDGSVYTTHAILLSSEKSSFTILLSNTETQEE KEILVLLEHQTKVLKKRHSQEKVLRRAKRRWAPIPCSVPENSLGPFPLFLQQIQSDTAQN*120 YTIYYSISGPGVDKEPRNLFYVERDTGNLFCTASIDRETYPLFELVAFATTPDGYTPEYP LTLVIRIEDENDNAPIFTETSYSFEVFENSKVGTTVGQVCATDQDEPDTLHTRLKYSIIE QFPALPTLFSMHPTTGVITTSSSKLDRELIDKYQLKIKVQDMDGQYFGLQTTAICIINIE DVNDNLPTFTRSSYVASVEENRIDVEILRVAVRDKDLINTANWRAN*346YTILKGNEDGNFKI VTDSQTNEGVLCVVKPLNYEEKQQVTLEIGVVNEAPYTGTSRSTTNMATVTVNVQNQDEG PECDPRVQTVRIKENVPVGTKTIGYKAYDPETGSSSGIRYKKSSDPEGWVDVDKNSGVIT ILKRLDREARSGVYN*495ISIIASDKDGRTCNGVLGIVLEDVNDNGPVIPQRTVVICKTVMSS AEIVAVDPDEPIHGPPFDFSLEGVSDSEVLRMWRLTKVN*579DTAARLSYLNDLRFGKYTVPV RVTDRLGQSLVTQLVVILCDCVTPNDCSFRPVSRTGNREVILGKWAILAILLGIALLFCI LFTLVCGATTGADKKPKVFPDDLAQQNLIVSNTEAPGDDKVYSTNDFTTHAVGGSAHGIG GTLGSRVKNGGQETIEMVKGGHQTMESCQETGHDHTLERCKEGGQHTLDSCRGGPVATDN CKYTYSEWYTYTQPRLGEKVQQCDQDNTHMQAQDYVLTYNYEGRGS*826AAGS*830VGCCS*835ERQEE DGLEFLDHLGPKFRTLAETCMKR
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 1TMH; ( 645 - 667)
Significance of PTMs Ser738 is an expected target for PKC phosphorylation.phosphorylation plays an important role in cell adhesion
Bibliography Haddad, S. (2006). Phosphorylation of desmocollin 2 in desmosome function. The University of Manchester (United Kingdom).