Search by BoMiProt ID - Bomi5082


Primary Information

BoMiProt ID Bomi5082
Protein Name Deoxyribonuclease-2-alpha
Organism Bos taurus
Uniprot IdP56541
Milk FractionWhey
Ref Sequence Id NP_001068595.1
Aminoacid Length 365
Molecular Weight 40282
Fasta Sequence https://www.uniprot.org/uniprot/P56541.fasta
Gene Name DNASE2
Gene Id 282218
Protein Existence Status reviewed

Secondary Information

PTMs Disulfide bond, Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P56541|DNS2A_BOVIN Deoxyribonuclease-2-alpha OS=Bos taurus OX=9913 GN=DNASE2 PE=2 SV=2 MATLSSLLLTALLWVPVGTLTCYGDSGQPVDWFVVYKLPAHTGSGDATQNGLRYKYFDEH SEDWSDGVGFINSTTGAVGRSLLPLYRNNNSQLAFVLYNDQPPKSSESKDSSSRGHTKGV LLLDQEGGFWLIHSVPNFPPRASSAVYSWPPGAQKYGQTLICVSFPLTQFLDISKQLTYT YPLVYDHRLEGDFAQKFPYLEEVVKGHHVRQGPWN*215SSVTLTSKKGATFQSFAKFGNFGDD LYSGWLSEALGSTLQVQFWQRSSGILPSN*269CSGAQHVFDVTQTAFPGPAGPAFN*293ATEDHSK WCVTPKGPWACVGDMNRNQREEHRGGGTLCAQMLWKAFKPLVKAWEPCEKKSRAYSLGSP AGLWT
Predicted Disorder Regions 2 predicted disordered segment; (101-117), (287-293)
DisProt Annotation
TM Helix Prediction No TM helices